DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinc1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_543120.1 Gene:Serpinc1 / 11905 MGIID:88095 Length:465 Species:Mus musculus


Alignment Length:395 Identity:133/395 - (33%)
Similarity:205/395 - (51%) Gaps:43/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWVTSVA-CQTSKEIYQLLSKS-HTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP--S 68
            :|..|.| .:.:...||.|:.| :.|.|:.:||:||.|..:|..:||...|.|:|.......  |
Mouse    81 VWELSKANSRFATNFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLKQLMEVFKFDTIS 145

  Fly    69 EDKEAVAARYGALLND--LQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTN 131
            |........:.|.||.  .:...:...|..|||::.:...:.|::|.......:.::.:.:....
Mouse   146 EKTSDQIHFFFAKLNCRLYRKANKSSDLVSANRLFGDKSLTFNESYQDVSEVVYGAKLQPLDFKE 210

  Fly   132 GPVAAE-RINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVT 195
            .|..:. .||.||.::|.|:||.:|..|::......:|||.|||||.|:|||.|..||...|...
Mouse   211 NPEQSRVTINNWVANKTEGRIKDVIPQGAINELTALVLVNTIYFKGLWKSKFSPENTRKEPFYKV 275

  Fly   196 ANKSVPVQMMAQMGTFRANYFRDLD-AQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVGFARP 259
            ..:|.||.||.|.|.|:  |.|..: .||:|||:...:::|.:.||:..:.|:.:|:::.    |
Mouse   276 DGQSCPVPMMYQEGKFK--YRRVAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEQELT----P 334

  Fly   260 LVAKE---------VYLKLPKFKIEFRDELKETLEKLGIRELFT-DKSDLSGLFADKSGGK---- 310
            .:.:|         :.:.:|:|:.|....|||.|:.:|:.:||: :||.|.|:.|   ||:    
Mouse   335 ELLQEWLDELSETMLVVHMPRFRTEDGFSLKEQLQDMGLIDLFSPEKSQLPGIVA---GGRDDLY 396

  Fly   311 VSQVSHKAFLEVNEEGAEAAGATSVAVT------NRAGFSTFLMADHPFAFVIRDA--NTIYFQG 367
            ||...|||||||||||:|||.:|||.:|      ||..|.    |:.||..:||:.  |||.|.|
Mouse   397 VSDAFHKAFLEVNEEGSEAAASTSVVITGRSLNPNRVTFK----ANRPFLVLIREVALNTIIFMG 457

  Fly   368 RVVSP 372
            ||.:|
Mouse   458 RVANP 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 127/381 (33%)
Serpinc1NP_543120.1 serpinC1_AT3 71..464 CDD:381002 133/395 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.