DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and LOC100909605

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:384 Identity:122/384 - (31%)
Similarity:185/384 - (48%) Gaps:34/384 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVACQT--SKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL--GLPSEDK 71
            |..:|.|  :..:|:.|...:.::|:|.|..||.|.|.::.:||:.:|.||:...|  .|....:
  Rat    36 TLSSCNTDFAFSLYKELVLKNPDKNIVFSSFSISTALVLLSLGAKNNTLKEILEGLKFNLTETPE 100

  Fly    72 EAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAA 136
            ..:...|..||..|....:...:...:.:::.....:...:....|..:::||.|........|.
  Rat   101 AEIHQGYEHLLQRLNLPGDQVQISTGSALFIKKHLQILAEFQEKARALYQAEAFSTDFQQPHEAK 165

  Fly   137 ERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVP 201
            :.||.:|..||.||||.:|  ..:......:|||.|||||:|:..|||..|..|.|.:...|||.
  Rat   166 KLINDYVRKQTQGKIKELI--SVLDKKTSMVLVNYIYFKGKWKMPFDPHDTFQSEFYLDEKKSVK 228

  Fly   202 VQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSALEEKIV----G 255
            |.|| ::......||||  |...|:||.| ..|.|....||     ::||  ::|:.:.:    .
  Rat   229 VPMM-KIEKLTTPYFRDEELSCSVLELKY-TGNASALFILPDQGRMQQVE--ASLQPETLRRWKD 289

  Fly   256 FARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGK---VSQVSHK 317
            ..||....|  |::|||.|.....|.:.|.:|||||:|:.::|||.:    :|.|   ||||.||
  Rat   290 TLRPRRIDE--LRMPKFSISTDMRLGDILPELGIREVFSQQADLSRI----TGAKDLSVSQVVHK 348

  Fly   318 AFLEVNEEGAEAAGATSVAVTNRAG--FSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372
            |.|:|.|.|.|||.||.|.:.....  :...:..:.||..:|.|.||  ..|..:|.:|
  Rat   349 AVLDVTETGTEAAAATGVKIIPMCAKFYYVTMYFNRPFLMIISDTNTHIALFMAKVTNP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 118/374 (32%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 118/374 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.