DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and serpine1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001108031.1 Gene:serpine1 / 100136840 ZFINID:ZDB-GENE-070912-60 Length:384 Species:Danio rerio


Alignment Length:384 Identity:109/384 - (28%)
Similarity:191/384 - (49%) Gaps:26/384 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCIFLWVTSVAC------QT--SKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKEL 60
            |.||....|..|      ||  ..:::....:|..::||.:||..|.::|.|..|||.|:|.|.|
Zfish     7 LLIFALCASSLCNLIQDKQTDFGLQVFAEAVQSAPDRNLALSPYGIASVLGMAQMGAYGATLKLL 71

  Fly    61 QSALGLPSEDKEAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAE 125
            .|.:|...::: .:......|..|| ..|:|  :::|:.:.|:.:..|.:.:..::.:.|:|...
Zfish    72 ASKMGYSLQER-GMPKLQRLLQRDL-ASEDG--VEVASGVMVDRKIILEKVFRRSLSKAFQSVPH 132

  Fly   126 SISLTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRAS 190
            .|..:...:|.:.||.|..|.|.|.|...:..|.::...:.:.:||::|.|.|::.|||..||..
Zfish   133 QIDFSQPEMARQVINSWTSDHTDGMISEFLPSGVLSELTRLVFLNALHFHGVWKTPFDPRNTREQ 197

  Fly   191 TFQVTANKSVPVQMMAQMGTFRANYF--RD-LDAQVIELPYLNSNLSMTIFLPREVE-GLSALEE 251
            .|......:|.|.||.....|....|  :| :|..|||:||...::||.:..|.|.: .||||.:
Zfish   198 LFHTVNGSAVSVPMMTTTQKFNYGEFVSKDGVDYDVIEMPYEGESISMLLVTPFEKDVPLSALNK 262

  Fly   252 -----KIVGFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFT-DKSDLSGLFADKSGGK 310
                 :|..:.:.:......|.:|:|.::...:||.||.::|:.::|: .::|.|.:..::. ..
Zfish   263 ELSSSRIHQWRQEMRKISKQLSIPRFSMDTEIDLKSTLSRMGLGDIFSQSRADFSRITTEEP-LC 326

  Fly   311 VSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDANT--IYFQG 367
            ||:|..:..|||||||.:.:.||:..:.:|.......: |.||.|:|:...|  :.|.|
Zfish   327 VSKVLQRVKLEVNEEGTKGSSATAAVIYSRMAVEEITL-DRPFFFLIQHKPTGALLFSG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 104/366 (28%)
serpine1NP_001108031.1 SERPIN 26..384 CDD:294093 102/363 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.