DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and serpina10b

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:363 Identity:115/363 - (31%)
Similarity:190/363 - (52%) Gaps:23/363 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPS---EDKEAVAARYGALL 82
            :|:.:|..| ::|:|.||:|:.|..|.:.:.|:|||..|:...|.|.:   .|...|...:..|.
Zfish    42 LYRKISSLH-DRNVVFSPLSVSTCFSALLLAAQGSTRTEILKGLNLEALDGGDSRRVPELFQQLH 105

  Fly    83 NDLQGQ-EEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQ 146
            .::..| |:|..|      :::..:.|..|::..::..|.:|...:..:...|....||::|..:
Zfish   106 QNISLQMEQGTAL------FLDQHFHLQTNFSQQIQRFFNAEVLRVDFSKPAVCRSLINEFVSRK 164

  Fly   147 TSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTF 211
            |..|:..|::  |:....:.||:|.|::||.||..|:|..|..|.|.|.....|.|.||.....|
Zfish   165 TGRKVLEMLE--SVEPLTQMLLLNTIFYKGDWERPFNPNNTEKSRFYVDKYNIVQVPMMMLEEKF 227

  Fly   212 RANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFARPLVAKEVYLKLPK 271
            .....|||.|:|:.||| ....||.|.||......:|:|     |::.|:.:.:...::.:.||:
Zfish   228 SVVEDRDLRARVLRLPY-RGGASMLILLPSADADYTAIEDEISAERLHGWIKNMRRMKMEVHLPR 291

  Fly   272 FKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVA 336
            |:::....:.|.|.:|||..:|.|.:||:||..| :..|||||.|||.:||.|:|..||.:|||.
Zfish   292 FRMDQSYHMHELLPQLGISSVFQDSADLTGLSRD-AHLKVSQVLHKAVIEVYEQGTSAASSTSVG 355

  Fly   337 VTNRAGFSTFLMADHPFAFVI--RDANTIYFQGRVVSP 372
            :|..:...||:: :.||.|.:  .:..::.|.|||:.|
Zfish   356 ITAYSLPDTFII-NRPFFFFLYHEETASLLFMGRVIDP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 112/358 (31%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 114/361 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.