DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINB11

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:391 Identity:123/391 - (31%)
Similarity:201/391 - (51%) Gaps:31/391 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAA 75
            ::.:..|..|.::.|...|..:|:..|.||:..||||..:|||.:|.:::..||........:..
Human     5 STANVEFCLDVFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETEEQLEKVLHFSHTVDSLKP 69

  Fly    76 KYKDL----------------LSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAE 124
            .:||.                .|::...:...|||:|||:|..|.......|....:..:.|..:
Human    70 GFKDSPKCSQAGRIHSEFGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLSCSEKWYQARLQ 134

  Fly   125 AIDIVDPNKAS-SIVNNWVDNQTRGKIKDLVSSNDMSKMELIVL-NAIYFKGQWEYKFNPKLTKK 187
            .:|.....:.: ..:|.||:|:|.||:.:|...:.:....::|| |||||||||:.||..:.|.|
Human   135 TVDFEQSTEETRKTINAWVENKTNGKVANLFGKSTIDPSSVMVLVNAIYFKGQWQNKFQVRETVK 199

  Fly   188 RNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIV 252
            ..|::|:.|:|.||||....:|:.|...|...:::||||.|:.|||:|.||..:..|.::||::.
Human   200 SPFQLSEGKNVTVEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLN 264

  Fly   253 G-------FKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEK-SADFKDLVENSNVHVK 309
            .       ....:.:.:|.:.||:||:|...:||.:|.::|:.|.|.: .||...:.....:::.
Human   265 SGTFHEWTSSSNMMEREVEVHLPRFKLETKYELNSLLKSLGVTDLFNQVKADLSGMSPTKGLYLS 329

  Fly   310 KVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIR--DRETIYFQGHFVK 372
            |.|||::::|:|||.||||||.......|:||.:.   |.|:|||.:.||  ...||.|.|....
Human   330 KAIHKSYLDVSEEGTEAAAATGDSIAVKSLPMRAQ---FKANHPFLFFIRHTHTNTILFCGKLAS 391

  Fly   373 P 373
            |
Human   392 P 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 122/383 (32%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 122/389 (31%)
RCL. /evidence=ECO:0000250 341..365 12/26 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B998
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.