DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINB7

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:377 Identity:103/377 - (27%)
Similarity:190/377 - (50%) Gaps:27/377 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL---------P 67
            :.:..|..:.::.:.......|:..|.||:..||::..:||:..:..::..:|.:         .
Human     6 AANAEFCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSS 70

  Fly    68 DDKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDP- 131
            :.:..:.::.|.:.|.:....|...||:.|.::..|.:.....|.:..:..:.|:.|.:|..:. 
Human    71 NSQSGLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVDFTNHL 135

  Fly   132 NKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVL-NAIYFKGQWEYKFNPKLTKKRNFRVSDQ 195
            ......:|.||:|:|.||||:::....:|...::|| ||:||||:|:..|....|...:|:....
Human   136 EDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHFKSPKC 200

  Fly   196 KSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFK----- 255
            ....|.||...:.|..:...:...||:||.| |..::|.:.||:  :.|||:|.|:. |:     
Human   201 SGKAVAMMHQERKFNLSVIEDPSMKILELRY-NGGINMYVLLPE--NDLSEIENKLT-FQNLMEW 261

  Fly   256 ---PKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVHVKKVIHKAF 316
               .:::...|.:..|:||||...::.:.|.|:|::|.|::| ||...:.....:::.:::||::
Human   262 TNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKADLSGIASGGRLYISRMMHKSY 326

  Fly   317 IEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRETIYFQG 368
            |||.|||.||.|||....|...:|..:   :|.|||||.:|||..:.|.|.|
Human   327 IEVTEEGTEATAATGSNIVEKQLPQST---LFRADHPFLFVIRKDDIILFSG 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 103/375 (27%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 103/377 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.