DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINH1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens


Alignment Length:372 Identity:102/372 - (27%)
Similarity:176/372 - (47%) Gaps:21/372 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVL---KLPDDKKEVAA 75
            |...|...||.:||:.|..|::.||:.|..:|.:..:|.:|.||.:.:.||   :|.|:  ||.|
Human    47 SAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDE--EVHA 109

  Fly    76 KYKDLLSKL-EGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVN 139
            ...:||..| ....:..|..|.:|:|..........:.:..|..:..|...|:..|...|...:|
Human   110 GLGELLRSLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSIN 174

  Fly   140 NWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMS 204
            .|....|.||:.::....:.:...|:| ||::||..|:.||:.|:...|.|.|:...:|.|.||.
Human   175 EWAAQTTDGKLPEVTKDVERTDGALLV-NAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVMMMH 238

  Fly   205 LFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVG-----FKPKLSKMDVT 264
            ....:....|.:...:|:|:|..:...|::|.:|..|:.|..|||.:..     :..|:.|..|.
Human   239 RTGLYNYYDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVA 303

  Fly   265 LRLPKFKIEFFAQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAA 328
            :.|||..:|....|.|.|..:|:.:|.:|: ||...:....::::..|.|....|::.:|.....
Human   304 ISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQ 368

  Fly   329 ATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRE--TIYFQGHFVKP 373
            .   ::.|..:..|.   :|.|||||.:::||.:  ::.|.|..|:|
Human   369 D---IYGREELRSPK---LFYADHPFIFLVRDTQSGSLLFIGRLVRP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 100/367 (27%)
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 102/372 (27%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.