DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINA6

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:396 Identity:105/396 - (26%)
Similarity:186/396 - (46%) Gaps:44/396 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLCLLLLAT--------------------------SVSCRFADDFYQLLAKENAANNLISSPLSV 41
            :.|||.|.|                          |.:..||...|:.|...:...|:..||:|:
Human     6 YTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSI 70

  Fly    42 EIALSMAYMGARAKTAQEMRNVL--KLPD-DKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNK 103
            .:||:|..:|....|..::...|  .|.: .:.|:...::.|.......:....:::.|.::::.
Human    71 SMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDG 135

  Fly   104 KFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLN 168
            ..:|:.|::..:|..:.:|..|::..|...||..:|::|.|:|:|||.||.|..| |...|:::|
Human   136 SLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLD-SPAILVLVN 199

  Fly   169 AIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSM 233
            .|:|||.|...|:...|::.||.|.:...|.|.||....:....|||||..:::::.|..:. ::
Human   200 YIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGNG-TV 263

  Fly   234 LIFLPDQ------VDGLSELEKKIVGFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFE 292
            ...|||:      :..||  ...|..:...|:...|.|.:||..|.....|..||..|||.|.|.
Human   264 FFILPDKGKMNTVIAALS--RDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFT 326

  Fly   293 KSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYV 357
            ..|:|..:.:::.:...||:|||.:::||||.:.|.:|.:     ::.:.|..::...:.||..:
Human   327 NQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGV-----TLNLTSKPIILRFNQPFIIM 386

  Fly   358 IRDRET 363
            |.|..|
Human   387 IFDHFT 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 99/359 (28%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 99/360 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.