DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SRP3

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_176586.1 Gene:SRP3 / 842706 AraportID:AT1G64030 Length:385 Species:Arabidopsis thaliana


Alignment Length:386 Identity:110/386 - (28%)
Similarity:181/386 - (46%) Gaps:85/386 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NNLISSPLSVEIALSMAYMG-------------ARAKTAQEMRNVLKLPDDKKEVAA-KYKDLLS 82
            :|:|.||.|:..|::|...|             .|:.:..|::.|.      :|:|: .|.|  .
plant    29 SNVIFSPASINSAITMHAAGPGGDLVSGQILSFLRSSSIDELKTVF------RELASVVYAD--R 85

  Fly    83 KLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDI-VDPNKASSIVNNWVDNQT 146
            ...|..|:   :.||.::::|.....|.:..:.::.|.|....:|. .:..:....||:||::.|
plant    86 SATGGPKI---TAANGLWIDKSLPTDPKFKDLFENFFKAVYVPVDFRSEAEEVRKEVNSWVEHHT 147

  Fly   147 RGKIKDLVSSNDMSKM-ELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQS-F 209
            ...||||:....::.: ..|..||:.|||.|:..|....|:..:|.:.:..||.|..||.::: :
plant   148 NNLIKDLLPDGSVTSLTNKIYANALSFKGAWKRPFEKYYTRDNDFYLVNGTSVSVPFMSSYENQY 212

  Fly   210 RAAHDSELGAKIIELPYR------NSSLSMLIFLPDQVDGLSELEKKIVG-----------FKPK 257
            ..|:|   |.|::.|||:      |...||..:|||:.|||.:|.:|:..           ::.:
plant   213 VRAYD---GFKVLRLPYQRGSDDTNRKFSMYFYLPDKKDGLDDLLEKMASTPGFLDSHIPTYRDE 274

  Fly   258 LSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEE 322
            |.|    .|:|||||||...:..||..:|::.                   ..:.|||.:|::||
plant   275 LEK----FRIPKFKIEFGFSVTSVLDRLGLRS-------------------MSMYHKACVEIDEE 316

  Fly   323 GAEAAAATA-------LLFVRYSMPMPSSQMVFNADHPFAYVIRDRE--TIYFQGHFVKPN 374
            |||||||||       |.||.     |..::.|.|||||.::||:.:  |:.|.|....|:
plant   317 GAEAAAATADGDCGCSLDFVE-----PPKKIDFVADHPFLFLIREEKTGTVLFVGQIFDPS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 109/380 (29%)
SRP3NP_176586.1 serpinP_plants 8..371 CDD:381001 109/383 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.