DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and AT1G64010

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001320592.1 Gene:AT1G64010 / 842704 AraportID:AT1G64010 Length:199 Species:Arabidopsis thaliana


Alignment Length:230 Identity:74/230 - (32%)
Similarity:118/230 - (51%) Gaps:59/230 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 IYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQ-SFRAAHDSELGAKIIELPYR-----N 228
            :||||.||.||:..:||.|:|.:.:..||.|.:||.:: .:..|:|   |.|:::||:|     :
plant     1 MYFKGAWEEKFHKSMTKDRDFHLINGTSVSVSLMSSYKDQYIEAYD---GFKVLKLPFRQGNDTS 62

  Fly   229 SSLSMLIFLPDQVDGLSELEKKI---VGF--------KPKLSKMDVTLRLPKFKIEFFAQLNKVL 282
            .:.||..:|||:.|||..|.:|:   |||        |.|:.:..:    |||||||....::..
plant    63 RNFSMHFYLPDEKDGLDNLVEKMASSVGFLDSHIPSQKVKVGEFGI----PKFKIEFGFSASRAF 123

  Fly   283 VAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALL------FVRYSMPM 341
            ..:|:.:                   ..:..||.:|::||||||.||||::      ||:     
plant   124 NRLGLDE-------------------MALYQKACVEIDEEGAEAIAATAVVGGFGCAFVK----- 164

  Fly   342 PSSQMVFNADHPFAYVIRDRE--TIYFQGHFVKPN 374
               ::.|.|||||.::||:.:  |:.|.|....|:
plant   165 ---RIDFVADHPFLFMIREDKTGTVLFVGQIFDPS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 73/224 (33%)
AT1G64010NP_001320592.1 serpin <1..195 CDD:393296 73/227 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.