DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPIN1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001320925.1 Gene:SERPIN1 / 841182 AraportID:AT1G47710 Length:418 Species:Arabidopsis thaliana


Alignment Length:373 Identity:122/373 - (32%)
Similarity:188/373 - (50%) Gaps:43/373 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPD-------DKKEVAAKYKDLLSKLEGREK 89
            :|:|.||.|:.:.||:...|:...|..::.:.||...       ..:.|:|...|  ....|..|
plant    56 SNVIFSPASINVVLSIIAAGSAGATKDQILSFLKFSSTDQLNSFSSEIVSAVLAD--GSANGGPK 118

  Fly    90 VATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSI---VNNWVDNQTRGKIK 151
               ||:||..:::|.....||:.|:::||:.|.:...|.  .:||..:   ||:|.:.:|.|.|.
plant   119 ---LSVANGAWIDKSLSFKPSFKQLLEDSYKAASNQADF--QSKAVEVIAEVNSWAEKETNGLIT 178

  Fly   152 DLV---SSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMM-SLFQSFRAA 212
            :::   |::.|:|  ||..||:||||.|..||:..||::..|.:.|...|....| |..:.:.:|
plant   179 EVLPEGSADSMTK--LIFANALYFKGTWNEKFDESLTQEGEFHLLDGNKVTAPFMTSKKKQYVSA 241

  Fly   213 HDSELGAKIIELPYRNS----SLSMLIFLPDQVDGLSELEKKIV---GFKPK-LSKMDVTLR--- 266
            :|   |.|::.|||...    ..||..:|||..:|||:|..|||   ||... :.:..|.:|   
plant   242 YD---GFKVLGLPYLQGQDKRQFSMYFYLPDANNGLSDLLDKIVSTPGFLDNHIPRRQVKVREFK 303

  Fly   267 LPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVEN----SNVHVKKVIHKAFIEVNEEGAEAA 327
            :||||..|....:.||..:|:...|.......::||:    .|:.|..:.|||.|||||||.|||
plant   304 IPKFKFSFGFDASNVLKGLGLTSPFSGEEGLTEMVESPEMGKNLCVSNIFHKACIEVNEEGTEAA 368

  Fly   328 AATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            ||:|.:.....:.|...::.|.|||||..|:.:..|  :.|.|..|.|
plant   369 AASAGVIKLRGLLMEEDEIDFVADHPFLLVVTENITGVVLFIGQVVDP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 120/368 (33%)
SERPIN1NP_001320925.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.