DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and AT3G45220

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_190108.1 Gene:AT3G45220 / 823658 AraportID:AT3G45220 Length:393 Species:Arabidopsis thaliana


Alignment Length:390 Identity:118/390 - (30%)
Similarity:192/390 - (49%) Gaps:45/390 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DFYQLLAKE---NAAN--NLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLP--DDKKEVAAKY 77
            |...||||.   ..||  ||:.||:|:.:.|.:...|:...|.:::.:.:.||  |....|.||.
plant    12 DVMVLLAKHVIPTVANGSNLVFSPMSINVLLCLIAAGSNCVTKEQILSFIMLPSSDYLNAVLAKT 76

  Fly    78 KDLLSKLEGREKV-ATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDI-VDPNKASSIVNN 140
            ..:... :|.|:. ..||.|..::::|.....||:..::::|:.|....:|. ..|.:..:.||.
plant    77 VSVALN-DGMERSDLHLSTAYGVWIDKSLSFKPSFKDLLENSYNATCNQVDFATKPAEVINEVNA 140

  Fly   141 WVDNQTRGKIKDLVSSNDMSKME---LIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEM 202
            |.:..|.|.||:::|.:.:..:.   ||:.||:||||.|..||:.||||..:|.:.|...|.|..
plant   141 WAEVHTNGLIKEILSDDSIKTIRESMLILANAVYFKGAWSKKFDAKLTKSYDFHLLDGTMVKVPF 205

  Fly   203 MSLF-QSFRAAHDSELGAKIIELPY--RNSSLSMLIFLPDQVDGLSELEKKIVGFKPKLSKMDV- 263
            |:.: :.:...:|   |.|::.|||  .....:|.|:||:..|||..|.::| ..||:.....: 
plant   206 MTNYKKQYLEYYD---GFKVLRLPYVEDQRQFAMYIYLPNDRDGLPTLLEEI-SSKPRFLDNHIP 266

  Fly   264 -------TLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVEN----------SNVHVKKV 311
                   ..::||||..|..:.:.||..||:...|...: ..::||:          .|:.|..|
plant   267 RQRILTEAFKIPKFKFSFEFKASDVLKEMGLTLPFTHGS-LTEMVESPSIPENLCVAENLFVSNV 330

  Fly   312 IHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKPN 374
            .|||.|||:|||.||||.:.....:..:.|..    |.|||||.:.:|:.::  |.|.|..:.|:
plant   331 FHKACIEVDEEGTEAAAVSVASMTKDMLLMGD----FVADHPFLFTVREEKSGVILFMGQVLDPS 391

  Fly   375  374
            plant   392  391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 117/384 (30%)
AT3G45220NP_190108.1 plant_SERPIN 8..390 CDD:238998 117/387 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.