DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and AT2G35580

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_181101.1 Gene:AT2G35580 / 818123 AraportID:AT2G35580 Length:374 Species:Arabidopsis thaliana


Alignment Length:380 Identity:109/380 - (28%)
Similarity:188/380 - (49%) Gaps:55/380 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KENAANN-----LISSPL-SVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAAKYKDLLSKLE 85
            ||:..|.     .:::|| :|.:::..|.......||.::.::|:.....|..|...:.:.:.| 
plant    18 KESVGNQNDIVLRLTAPLINVILSIIAASSPGDTDTADKIVSLLQASSTDKLHAVSSEIVTTVL- 81

  Fly    86 GREKVA----TLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSI---VNNWVD 143
             .:..|    |:|.||.:::.|...:.||:..::.:|:.|....:|.  ..||..:   ||:||:
plant    82 -ADSTASGGPTISAANGLWIEKTLNVEPSFKDLLLNSYKAAFNRVDF--RTKADEVNREVNSWVE 143

  Fly   144 NQTRGKIKDLVSSNDMSK--MELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLF 206
            .||.|.|.:|:.||..|.  .:.|..||::|.|:|:.:|:|.|||..:|.:.|...|.|..|: .
plant   144 KQTNGLITNLLPSNPKSAPLTDHIFANALFFNGRWDSQFDPSLTKDSDFHLLDGTKVRVPFMT-G 207

  Fly   207 QSFRAAHDSELGAKIIELPYR-----NSSLSMLIFLPDQVDGLSELEKKIV---GF------KPK 257
            .|.|..|..| |.|:|.|.||     :.|.||.|:|||:.|||..:.:::.   ||      .|.
plant   208 ASCRYTHVYE-GFKVINLQYRRGREDSRSFSMQIYLPDEKDGLPSMLERLASTRGFLKDNEVLPS 271

  Fly   258 LSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEE 322
            .|.:...|::|:||.:|..:.::.|...|:.                 |.:..::||:.|||:|.
plant   272 HSAVIKELKIPRFKFDFAFEASEALKGFGLV-----------------VPLSMIMHKSCIEVDEV 319

  Fly   323 GAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKPNE 375
            |::||||.|...:....| |..:..|.|||||.:::::..:  :.|.|..:.|::
plant   320 GSKAAAAAAFRGIGCRRP-PPEKHDFVADHPFLFIVKEYRSGLVLFLGQVMDPSK 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 108/373 (29%)
AT2G35580NP_181101.1 plant_SERPIN 8..371 CDD:238998 108/376 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.