DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina3a

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001161177.1 Gene:Serpina3a / 74069 MGIID:1921319 Length:422 Species:Mus musculus


Alignment Length:381 Identity:110/381 - (28%)
Similarity:189/381 - (49%) Gaps:31/381 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL---PDDKKEV 73
            |::..||...|:.||.:|...|::.||||:..||::..:||:..|.:|:...||.   ...:.::
Mouse    51 SINTDFAFSLYKKLALKNPHKNIVFSPLSISAALALMSLGAKDNTLEEILEGLKFNLTETPEADI 115

  Fly    74 AAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIV 138
            ...:..||..|...|....::..|.::::|..|::..:.:..:..:.|||...|...|.:|:.::
Mouse   116 HQNFGHLLQMLIQPENQVQINAGNALFIDKHLQILTEFKEKARALYKAEAFTADFQLPREATKLI 180

  Fly   139 NNWVDNQTRGKIKDLVSSNDMSK-MELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEM 202
            |::|..||:||||:|||  |:.: ..:.::|.:.|:|.|...|:|:.|...||.:..:::|.|.|
Mouse   181 NDYVRKQTQGKIKELVS--DLHRNTSMALVNFLNFQGFWNVTFDPEDTFLGNFTLDRKRTVNVPM 243

  Fly   203 MSLFQ----SFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQ------VDGL--SELEKKIVGFK 255
            |...:    .||   |.|:.:.::||.|..:: |.|..||||      .|.|  ..|.|.....:
Mouse   244 MKTEELTTNYFR---DEEMQSTVMELNYIGNA-SFLFILPDQGRIQHVEDSLQPQSLRKWRKSLR 304

  Fly   256 PKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVN 320
            |::  :| .|.||||.:.....||.:|..:||::.|...||...:....|:.|.::||:|.::|.
Mouse   305 PRM--LD-ELSLPKFSLSQDYNLNDILPELGIKEVFSTQADLSGITGAKNIRVSQMIHQAALDVT 366

  Fly   321 EEGAEAAAATALLFVRYSMPMPS-SQMVFNADHPFAYVIRDR--ETIYFQGHFVKP 373
            |...||...|   ..||:..... ...:...|..|.|:|.|.  ::|...|..:.|
Mouse   367 ETHTEADVIT---IARYNFQSAKIKAKIVKVDREFLYLILDPMFKSISVMGKVINP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 108/374 (29%)
Serpina3aNP_001161177.1 SERPIN 53..416 CDD:294093 108/374 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.