DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb12

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001186142.1 Gene:Serpinb12 / 71869 MGIID:1919119 Length:423 Species:Mus musculus


Alignment Length:422 Identity:132/422 - (31%)
Similarity:217/422 - (51%) Gaps:62/422 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVL----------K 65
            |:.:.:|..||::.::|::|..|:...|||:..|..|..:|||..:|.::...|          |
Mouse     5 TAANNKFCFDFFREISKDDAHKNIFVCPLSLSAAFGMVRLGARGDSAHQIDEALHFNELSKDEHK 69

  Fly    66 LPDD----------------KKEVAAK-----------------YKDLLSKLEGREKVATLSLAN 97
            .|:|                :|:.:|.                 :..|||:::..:...|||:||
Mouse    70 EPNDPSPQSESKASDSSLEGQKQTSASQDQQGESTNDHQLLGCHFGKLLSRIDRDKSYYTLSMAN 134

  Fly    98 RIYVNKKFQLVPSYNQMVKDSFMAEAEAIDI-VDPNKASSIVNNWVDNQTRGKIKDLVSSNDMSK 161
            |:|..::|.:...|:..|.:.|....|::|. .|..|:...:|.||::|::||||:|.....:..
Mouse   135 RLYGEQEFPICSEYSDDVTEFFHTTVESVDFQKDSEKSRQEINFWVESQSQGKIKELFGKEAIDN 199

  Fly   162 MELIVL-NAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELP 225
            ..::|| ||:|||.:||.:||.:.|...:|.:::.:...|:||:....||.....||.|:|:|:.
Mouse   200 STVLVLVNAVYFKAKWEREFNSENTVDASFCLNENEKKTVKMMNQKGKFRIGFIDELQAQILEMK 264

  Fly   226 YRNSSLSMLIFLP----DQVDGLSELEKKIVGFK-------PKLSKMDVTLRLPKFKIEFFAQLN 279
            |....||||:.||    |.|:.|.||||||...|       ..||:..|.:..|:|.:|....|.
Mouse   265 YAMGKLSMLVLLPSCSEDNVNSLQELEKKINHEKLLAWSSSENLSEKPVAISFPQFNLEDSYDLK 329

  Fly   280 KVLVAMGIQDAF-EKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPS 343
            .:|..|||:|.| |..||...:.::.|:::.|::||.|:||:|.|.:||||:.::....::|   
Mouse   330 SILQDMGIKDVFDETKADLTGISKSPNLYLSKIVHKTFVEVDEMGTQAAAASGVVAAEKALP--- 391

  Fly   344 SQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            |.:.|||:|||.:.||...|  :.|.|....|
Mouse   392 SWVEFNANHPFLFFIRHNPTQSLLFCGRVYCP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 130/414 (31%)
Serpinb12NP_001186142.1 SERPIN 4..423 CDD:294093 131/420 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..106 5/42 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.