DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPING1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_000053.2 Gene:SERPING1 / 710 HGNCID:1228 Length:500 Species:Homo sapiens


Alignment Length:373 Identity:95/373 - (25%)
Similarity:164/373 - (43%) Gaps:48/373 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAAKYKDLLSKLE 85
            ::...|.:....|:..||.|:...|:...:||...|...:.::|..|.|...|....|...:|  
Human   154 YHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTK-- 216

  Fly    86 GREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASS-------IVNNWVD 143
               .|.::|           |:..|.:..::|:|:..:..:....|...|:       ::|.||.
Human   217 ---GVTSVS-----------QIFHSPDLAIRDTFVNASRTLYSSSPRVLSNNSDANLELINTWVA 267

  Fly   144 NQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQS 208
            ..|..||..|:.|.. |...|::|||||...:|:..|:||.|:...|...: ..:.|.||: .:.
Human   268 KNTNNKISRLLDSLP-SDTRLVLLNAIYLSAKWKTTFDPKKTRMEPFHFKN-SVIKVPMMN-SKK 329

  Fly   209 FRAAH--DSELGAKIIELPYRNSSLSMLIFLP--------DQVDGLSELEKKIVGFKPKLSKMDV 263
            :..||  |..|.||:.:|.. :.:||::|.:|        |....||....|.:..|.::||...
Human   330 YPVAHFIDQTLKAKVGQLQL-SHNLSLVILVPQNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQP 393

  Fly   264 T-LRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAA 327
            | |.||:.|:.....:..::..:...| |....:...|.|:.::.|..:.|:..:|:.|.|.|||
Human   394 TLLTLPRIKVTTSQDMLSIMEKLEFFD-FSYDLNLCGLTEDPDLQVSAMQHQTVLELTETGVEAA 457

  Fly   328 AATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRETIY--FQGHFVKP 373
            ||:|:...|       :.:||....||.:|:.|::..:  |.|....|
Human   458 AASAISVAR-------TLLVFEVQQPFLFVLWDQQHKFPVFMGRVYDP 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 94/368 (26%)
SERPING1NP_000053.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..118
7 X 4 AA tandem repeats of [QE]-P-T-[TQ] 85..119
C1_inh 145..495 CDD:239005 94/368 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.