DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpine3

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:385 Identity:94/385 - (24%)
Similarity:161/385 - (41%) Gaps:49/385 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLLATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDK 70
            |.||.|    .||...||..|.|....|.:.||.||.::|.:....||..|..::...|......
  Rat    28 LWLLKT----EFALHLYQSAAAETNGTNFVISPASVSLSLEILQFAARGNTGWQLAEALGYTVQD 88

  Fly    71 KEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKAS 135
            ..|......:...|....:...:.||..:::.....|.|.:.:.|.....:..|..|..:||..:
  Rat    89 PRVREFLHTVYITLHNSSQGIGMELACTLFMQTGTSLSPCFVEQVSRWANSSLELADFSEPNTTT 153

  Fly   136 SIVNNWVDNQTRGKIKDLVSSNDMSKM---------ELIVLNAIYFKGQWEYKFNPKLTKKRNFR 191
            .       ..::|..:........|.:         :|.:::.:.|:..|:.:|:....:...|.
  Rat   154 M-------EASKGTTRPSTGEGPGSPLWGRAGALSTQLSIVSTMTFQSSWQQRFSSVALQPLPFT 211

  Fly   192 VSDQKSVPVEMM--------SLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLP-DQVDGLSEL 247
            .:....:.|..|        ..||. .|.|..:    ::||.|.....|:|:.|| |:...|..:
  Rat   212 CAHGLVLQVPAMHQVAEVSYGQFQD-AAGHKVD----VLELLYLGRVASLLLVLPQDKGTPLDHI 271

  Fly   248 EKKIVG-------FKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEK-SADFKDLVENS 304
            |..:..       .:.|.::|||.  ||:|:|:....|..:|.:.||.|.|:. .|:.|.:....
  Rat   272 EPHLTARVIHLWTTRLKRARMDVF--LPRFRIQNQFDLKSILRSWGITDLFDPLKANLKGISGRD 334

  Fly   305 NVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRETI 364
            ..:|.:|.|||.:|::|||.::.||||:|.:|.|. .|:    |.||.||.:::|:..|:
  Rat   335 GFYVSEVTHKAKMELSEEGTKSCAATAVLLLRRSR-TPA----FKADRPFIFLLREHNTV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 90/377 (24%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 94/385 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.