DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINA7

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens


Alignment Length:397 Identity:105/397 - (26%)
Similarity:180/397 - (45%) Gaps:47/397 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVL--KLPDDKK-E 72
            :|::..||.:.|:....|....|:..||:|:..||.|...||...|..|:...|  .|.|... |
Human    43 SSINADFAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVE 107

  Fly    73 VAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSI 137
            :...::.|:..|...:|...|.:.|.:::.|..:.:..:...||..:..|..:.|..:.:.|...
Human   108 IQHGFQHLICSLNFPKKELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQE 172

  Fly   138 VNNWVDNQTRGKIKDLVSSNDMSKMELIVL-NAIYFKGQWEYKFNPKLTK-KRNFRVSDQKSVPV 200
            :|:.|:.||:||:..|:  .|:....::|| |.|:||.||...|:|..|: ..:|.:....:|.|
Human   173 INSHVEMQTKGKVVGLI--QDLKPNTIMVLVNYIHFKAQWANPFDPSKTEDSSSFLIDKTTTVQV 235

  Fly   201 EMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLP--DQVDGLSEL--EKKIVGFKPKLSKM 261
            .||...:.:....|.||...::::.|..::|::.: ||  .|::.:...  .|.:..:...|.|.
Human   236 PMMHQMEQYYHLVDMELNCTVLQMDYSKNALALFV-LPKEGQMESVEAAMSSKTLKKWNRLLQKG 299

  Fly   262 DVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVK----------KVIHKAF 316
            .|.|.:|||.|.....|...|:.||||.|:.::|||..|.|::.:.:.          :..|||.
Human   300 WVDLFVPKFSISATYDLGATLLKMGIQHAYSENADFSGLTEDNGLKLSNRPAGFVLPTQAAHKAV 364

  Fly   317 IEVNEEGAEAAAATALLFVRYSMPMPSSQM-----------VFNADHPFAYVIRDRET--IYFQG 368
            :.:.|:|.||||            :|..::           :...|..|..:|.:|.|  |.|.|
Human   365 LHIGEKGTEAAA------------VPEVELSDQPENTFLHPIIQIDRSFMLLILERSTRSILFLG 417

  Fly   369 HFVKPNE 375
            ..|.|.|
Human   418 KVVNPTE 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 101/387 (26%)
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 101/387 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.