DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina1f

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:413 Identity:86/413 - (20%)
Similarity:181/413 - (43%) Gaps:62/413 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCLLLLATSVS----------------------CRFADDFYQLLAKENAANNLISSPLSVEIALS 46
            ||.|||.|...                      |..:...::.:|:.:...|::.||:.|..|:|
Mouse    16 LCCLLLITKTKHEKLYEDPSIDPFQCRKVALTICNVSITLFKKMAQLSGNGNILFSPIRVIAAIS 80

  Fly    47 MAYMGARAKTAQEMRNVLK-----LPDDKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQ 106
            |..:|:....::.:...|:     ||:  .|:...:..||..:...|:.::|...:.:::::...
Mouse    81 MLSLGSNGNLSKHILETLRFNKTGLPE--AEIHKCFWYLLHSIHQTEEPSSLQTGSSVFIHQDLT 143

  Fly   107 LVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIY 171
            .|..:.:.|||.:.::..:|:..|.::|.:.:||:|..:::.:|.::| .|..|...|.|:|.|.
Mouse   144 SVDKFVKGVKDLYHSDMISINFTDSSQAKTQINNYVMEKSQKEIVNIV-KNLESDTFLAVVNYII 207

  Fly   172 FKGQWEYKFNPKLTKKRNFRVSDQKSVPVEM---MSLFQSFRAAHDSELGAKIIELPYRNSSLSM 233
            :..:.:..|..:..|.:::.:....::.|.|   |::...||.   .:|.:.::.|.....:.:.
Mouse   208 WNAKLDSNFGCRSVKVKDYHLGYGMTIKVPMIHNMAMHYLFRV---EDLSSTVLMLTLLTGNFAT 269

  Fly   234 LIFLPDQVDGLSELEKKIVGFKPKLSKMD-------VTLRLPKFKIEFFAQLNKVLVAMGIQDAF 291
            ...:||. ..:.::|:.:.  .|...:|.       |.|.:|:..:.....|..::..:||...|
Mouse   270 YFIIPDP-GKMQKVEQSLT--YPHFRRMRRQLLTRLVDLEIPELSLSETHDLESMMSLLGITYVF 331

  Fly   292 E---KSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRY-SMPMPSSQMVFNADH 352
            .   .|:|..|.::.|    .||:.||.:.::|:|::  .:|...|.:. |..|...|:    :.
Mouse   332 NSGTNSSDMNDTLQKS----FKVVSKAVLTIDEKGSK--PSTNSCFKKLGSTDMGRMQL----NR 386

  Fly   353 PFAYVIRD--RETIYFQGHFVKP 373
            ||...|:|  .:...|.|..|.|
Mouse   387 PFLIFIQDHTNDVPLFLGRVVNP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 78/398 (20%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 79/379 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.