DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina5

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001231668.1 Gene:Serpina5 / 65051 RGDID:619817 Length:442 Species:Rattus norvegicus


Alignment Length:374 Identity:110/374 - (29%)
Similarity:198/374 - (52%) Gaps:15/374 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKT-AQEMRNV-LKLPDDKK 71
            :.||.|..||...|:.||.|....|:..||:||.::|.|..:|:..|| ||.:..: |.|...::
  Rat    75 VGTSRSRDFAFRLYRALASEAPGQNVFFSPMSVSMSLGMLSLGSGLKTKAQILEGLGLSLQQGQE 139

  Fly    72 EVAAK-YKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKAS 135
            ::..| ::.||.:.........|||.:.::.:....:...:...:|..:|::..:.:..:|..|.
  Rat   140 DMLHKGFQQLLQQFSQPSDGLQLSLGSALFTDPAVHIRDHFLSAMKTLYMSDMFSTNFGNPESAK 204

  Fly   136 SIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPV 200
            ..:|::|..:|.|||.||:...|.:.: ::|:|.|:||.:|:..|:...|.|.::.|:.:|::.|
  Rat   205 KQINDYVAKKTNGKIVDLIKDLDSTHV-MVVVNYIFFKAKWQTAFSSTNTHKMDYHVTPKKTIQV 268

  Fly   201 EMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQ------VDGLSELEKKIVGFKPKLS 259
            .||:....:....|..:...::.:||:.::.::.| ||.:      .|||.  |:.:..:....:
  Rat   269 PMMNREDIYSYILDQNISCTVVGIPYQGNTFALFI-LPSEGKMKRVEDGLD--ERTLRNWLKMFT 330

  Fly   260 KMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGA 324
            |..:.|.||||.||...:|.|:|..:||||.|...||...|.:::|:.:.:::||:.:||:|.|.
  Rat   331 KRQLDLYLPKFSIEGTYKLEKILPKLGIQDIFTTHADLSGLTDHTNIKLSEMVHKSMVEVDESGT 395

  Fly   325 EAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRETIYFQGHFVKP 373
            .|||:|.:||...|....|.::.|.  .||..||.|...:||.|..::|
  Rat   396 TAAASTGILFTLRSARPSSLKVEFT--RPFLVVIMDGTNLYFIGKVIQP 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 107/364 (29%)
Serpina5NP_001231668.1 alpha-1-antitrypsin_like 81..439 CDD:239011 106/363 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.