DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINE3

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001094790.1 Gene:SERPINE3 / 647174 HGNCID:24774 Length:424 Species:Homo sapiens


Alignment Length:401 Identity:107/401 - (26%)
Similarity:179/401 - (44%) Gaps:53/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLCLLLL-------ATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEM 60
            |.|.|..       .|.:...||...||.:|......|.:.||..|.:.|.:...||...|.|::
Human    12 HSCCLRANGHLREGMTLLKTEFALHLYQSVAACRNETNFVISPAGVSLPLEILQFGAEGSTGQQL 76

  Fly    61 RNVLKLPDDKKEVA----AKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMA 121
            .:.|......|.|.    |.|..|.:..:|.|    :.||..::|.....|.|.:.:.|.....:
Human    77 ADALGYTVHDKRVKDFLHAVYATLPTSSQGTE----MELACSLFVQVGTPLSPCFVEHVSWWANS 137

  Fly   122 EAEAIDIVDPNKASSIVNNWVDNQTRGKIK---------DLVSSNDMSKMELIVLNAIYFKGQWE 177
            ..|..|:.:||..:...:.....:|.|...         :.||:   :..:|::::.:.|:|.|.
Human   138 SLEPADLSEPNSTAIQTSEGASRETAGGGPSEGPGGWPWEQVSA---AFAQLVLVSTMSFQGTWR 199

  Fly   178 YKFNPKLTKKRNFRVSDQKSVPVEMMSL-----FQSFRAAHDSELGAKIIELPYRNSSLSMLIFL 237
            .:|:...|:...|..:....:.|.||..     :..|:.....::|  ::||||..|::|:.:.|
Human   200 KRFSSTDTQILPFTCAYGLVLQVPMMHQTTEVNYGQFQDTAGHQVG--VLELPYLGSAVSLFLVL 262

  Fly   238 P-DQVDGLSELEKKIVGFKPKL-------SKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEK- 293
            | |:...||.:|..:......|       ::|||.  ||:|:|:....|..:|.:.|:.|.|:. 
Human   263 PRDKDTPLSHIEPHLTASTIHLWTTSLRRARMDVF--LPRFRIQNQFNLKSILNSWGVTDLFDPL 325

  Fly   294 SADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVI 358
            .|:.|.:......:|.:.||||.|||.|||.:|:.|||||.::.|. :|    :|.||.||.|.:
Human   326 KANLKGISGQDGFYVSEAIHKAKIEVLEEGTKASGATALLLLKRSR-IP----IFKADRPFIYFL 385

  Fly   359 RDRE---TIYF 366
            |:..   |::|
Human   386 REPNTGITVFF 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 103/383 (27%)
SERPINE3NP_001094790.1 SERPIN 31..399 CDD:238101 103/382 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..174 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.