DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINB4

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_002965.1 Gene:SERPINB4 / 6318 HGNCID:10570 Length:390 Species:Homo sapiens


Alignment Length:392 Identity:134/392 - (34%)
Similarity:210/392 - (53%) Gaps:35/392 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVL---KLPDDKKE 72
            :..:.:|..|.:|...| :..||:..||:|:..||.|..:||:..|||::..||   ::.::..|
Human     5 SEANTKFMFDLFQQFRK-SKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTENTTE 68

  Fly    73 VAAKY------------KDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEA 125
            .||.|            :.||::.........|.:||:::..|.:|.:..|...:|..:....|:
Human    69 KAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFYQTSVES 133

  Fly   126 IDIVD-PNKASSIVNNWVDNQTRGKIKDL----VSSNDMSKMELIVLNAIYFKGQWEYKFNPKLT 185
            .|..: |.::...:|:||::||..|||:|    ...||.:   |:::||||||||||.||..:.|
Human   134 TDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTT---LVLVNAIYFKGQWENKFKKENT 195

  Fly   186 KKRNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKK 250
            |:..|..:......|:||..:.||..|...::.||::|:||:...|||::.||:::|||.:||:|
Human   196 KEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEK 260

  Fly   251 IVGFK-------PKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHV 308
            :...|       ..:.:..|.|.||:||:|....|...|..||:.:.|...||...:..:..:.|
Human   261 LTAEKLMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSV 325

  Fly   309 KKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFV 371
            .||:||||:||.|||.|||||||::.|..|  .||:...|..:|||.:.||..:|  |.|.|.|.
Human   326 SKVLHKAFVEVTEEGVEAAAATAVVVVELS--SPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFS 388

  Fly   372 KP 373
            .|
Human   389 SP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 132/384 (34%)
SERPINB4NP_002965.1 SERPIN 4..390 CDD:320777 133/390 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 1 0.900 - - E33208_3B998
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.