DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINB3

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_008850.1 Gene:SERPINB3 / 6317 HGNCID:10569 Length:390 Species:Homo sapiens


Alignment Length:389 Identity:128/389 - (32%)
Similarity:208/389 - (53%) Gaps:29/389 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLP-------- 67
            :..:.:|..|.:|...| :..||:..||:|:..||.|..:||:..|||:::.||...        
Human     5 SEANTKFMFDLFQQFRK-SKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTG 68

  Fly    68 -------DDKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEA 125
                   |....|..:::.||::.........|.:||:::..|.:..:..|...:|..:....|:
Human    69 KAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVES 133

  Fly   126 IDIVD-PNKASSIVNNWVDNQTRGKIKDLVSSNDM-SKMELIVLNAIYFKGQWEYKFNPKLTKKR 188
            :|..: |.::...:|:||::||..|||:|:...:: |...|:::||||||||||.|||.:.||:.
Human   134 VDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEE 198

  Fly   189 NFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVG 253
            .|..:......::||..:.||..|...::.||::|:||:...|||::.||:::|||.:||:|:..
Human   199 KFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTA 263

  Fly   254 FK-------PKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKV 311
            .|       ..:.:..|.|.||:||:|....|...|..||:.|.|...||...:..:..:.:..|
Human   264 EKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGV 328

  Fly   312 IHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            :||||:||.|||||||||||:  |.:.....|:...|:.:|||.:.||..:|  |.|.|.|..|
Human   329 LHKAFVEVTEEGAEAAAATAV--VGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 126/381 (33%)
SERPINB3NP_008850.1 serpinB3_B4_SCCA1_2 1..390 CDD:381030 127/387 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.