DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina3i

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_017170641.1 Gene:Serpina3i / 628900 MGIID:2182841 Length:457 Species:Mus musculus


Alignment Length:395 Identity:118/395 - (29%)
Similarity:200/395 - (50%) Gaps:59/395 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMR-----NVLKLP 67
            |...|.:..||...|:.|..:|...|::.||.|:..||::..:||::.|.:|:.     |:.:.|
Mouse    70 LTVASSNTDFAFSLYRKLVLKNPDENVVFSPFSIFTALALLSLGAKSNTLKEILEGLKFNLTETP 134

  Fly    68 DDKKEVAAKY-KDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDP 131
            :.......:| .||||:...:.:::|   .:.::|.|..|::..:.:..:..:.|||...|.:.|
Mouse   135 EPDIHQGFRYLLDLLSQPGDQVQIST---GSALFVEKHLQILAEFKEKARALYQAEAFTADFLQP 196

  Fly   132 NKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFK--------------GQWEYKFNP 182
            .:|..::|::|.|||:||||:|:|..|.|.: ::::|.||||              |:|:..|:|
Mouse   197 CQAKKLINDYVSNQTQGKIKELISDLDKSTL-MVLVNYIYFKGGRGHCLGVEREELGKWKMPFDP 260

  Fly   183 KLTKKRNFRVSDQKSVPVEMMSLFQ----SFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDG 243
            :.|....|.:.:::||.|.||.:.:    .||   |.||...::||.|..:: |.|..|||| ..
Mouse   261 RDTFNSKFYLDEKRSVKVPMMKIEELTTPYFR---DDELSCSVVELKYTGNA-SALFILPDQ-GK 320

  Fly   244 LSELEKKI---------VGFKP-KLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFK 298
            :.::|..:         ...|| ::|:    |.||||.|.....|..||..:||::.|...||..
Mouse   321 MQQVETSLHPETLRKWKNSLKPSRISE----LHLPKFSISNDYSLEHVLPVLGIREVFSMQADLS 381

  Fly   299 DLVENSNVHVKKVIHKAFIEVNEEGAEAAAATAL-LFVR----YSMPMPSSQMVFNADHPFAYVI 358
            .:....::.|.:|:|||.::|.|.|.||||||.: :.:|    |||.:...:       ||..:|
Mouse   382 AITGTMDLRVSQVVHKAVLDVTETGTEAAAATGVKVNLRCGKIYSMTIYFKR-------PFLIII 439

  Fly   359 RDRET 363
            .|..|
Mouse   440 SDINT 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 116/389 (30%)
Serpina3iXP_017170641.1 serpinA3_A1AC 62..457 CDD:381019 118/395 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.