DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and serpinb14

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_002665111.3 Gene:serpinb14 / 569051 ZFINID:ZDB-GENE-050506-148 Length:437 Species:Danio rerio


Alignment Length:436 Identity:138/436 - (31%)
Similarity:226/436 - (51%) Gaps:76/436 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVL----------- 64
            ::.:.:|:.:.::.::..||:.|:..||:|:..||:|..:||:..||.:|..||           
Zfish     5 SAANTQFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNNLPKSAGA 69

  Fly    65 --------------------------------------------KLPDDKKE--VAAKYKDLLSK 83
                                                        .:|..|.|  :.:.:...:|:
Zfish    70 TPEAHQSMMQQAQKPKSGVKDQHGQAMMQQTQKIDIPAELKKGSAVPGQKAEEQIHSNFNKFMSE 134

  Fly    84 LEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSI-VNNWVDNQTR 147
            |........||||||:|..:.:|.|..:....|..:.|..|.:|..:.::|:.: :|.||:..|:
Zfish   135 LNKPGAPYVLSLANRLYGEQTYQFVEKFLSDAKRYYEAGLEKVDFKNKSEAARVNINTWVEKNTQ 199

  Fly   148 GKIKDLVSSNDMSKM-ELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRA 211
            .|||||:.|..:..| .|:::|||||||.||.||..:.|....|:::..::.||:||.....|..
Zfish   200 EKIKDLLPSGAIDAMTRLVLVNAIYFKGNWERKFPKEATNDGQFKLNKNQTKPVKMMYQKAHFPL 264

  Fly   212 AHDSELGAKIIELPYRNSSLSMLIFLPDQVD----GLSELEK-----KIVGF-KPK-LSKMDVTL 265
            |...|:.::::||||...:|||||.||||::    ||.:|||     |::.: ||: :.:.:|.:
Zfish   265 ASIPEMNSQVLELPYVGKNLSMLIILPDQIEDATTGLEKLEKALTYEKLMEWTKPEVMRQQEVQV 329

  Fly   266 RLPKFKIEFFAQLNKVLVAMGIQDAFE-KSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAA 329
            .|||||:|....:..:||:||::|.|: :..:...:..::::.:.|||||||:||||||.|||||
Zfish   330 SLPKFKMEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKVIHKAFVEVNEEGTEAAAA 394

  Fly   330 TALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            |..:.:...:.:|.|   |||||||.:.||...|  |.|.|.|..|
Zfish   395 TGAIMMLRCIRLPQS---FNADHPFLFFIRHNPTKSILFYGRFCSP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 136/428 (32%)
serpinb14XP_002665111.3 SERPIN 4..437 CDD:294093 137/434 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3432
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.