DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and serping1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_005166940.3 Gene:serping1 / 567801 ZFINID:ZDB-GENE-030131-1262 Length:652 Species:Danio rerio


Alignment Length:392 Identity:103/392 - (26%)
Similarity:172/392 - (43%) Gaps:73/392 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLP-------DDKKEVA 74
            |:...|..|....|..|||.||:|:..|||...:|||.||...:...|.||       .:.|::.
Zfish   299 FSTSVYSRLKGSKAKANLIFSPISIAAALSNLLLGARGKTRMHLEGALGLPLGFSCLHTELKKLR 363

  Fly    75 AKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVN 139
            ...||            ||.:|:.|:.|.:.||..::....|:.:....:.: ..|..:..:::|
Zfish   364 GVMKD------------TLKMASAIFYNPEQQLAEAFINQSKEFYEFVPQKL-TNDSTRNVALIN 415

  Fly   140 NWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMS 204
            .||:|:|..||..|:...|.| ...::|||:||.|:|:..|.....|::....|.:..   ::.:
Zfish   416 KWVENKTNKKITQLIDDVDPS-TTFVLLNAVYFNGKWKTVFESTNNKEKFTMFSGETK---DVKT 476

  Fly   205 LFQS---FRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSE-----LEKKI--VGFKPKLS 259
            |:.|   .:..::.:|.|.:.:.|....: |:.|.:|..   |||     :|..|  ...:..:|
Zfish   477 LYSSNYILQMGYNKQLKADVGKFPLTGQN-SLYILVPRT---LSEESFLLMENNINRNTLEEMVS 537

  Fly   260 KMDVT------LRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNV----------HV 308
            :|:.|      :.||..|:....|::.:|..||:.|.|          .|.|:          .:
Zfish   538 EMNQTPAQSAEVTLPAIKLTMTTQVDDLLRNMGLSDLF----------NNPNLCGMFPGEPESFI 592

  Fly   309 KKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRETI--YFQGHFV 371
            ..|.|:||:.:.|:|.||||||::.|.|       |...|:|..||..::...|..  .|.|..:
Zfish   593 SDVRHRAFLSLTEKGVEAAAATSISFSR-------SFSSFSALQPFVLILWSDEAAVPLFMGRII 650

  Fly   372 KP 373
            .|
Zfish   651 NP 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 102/387 (26%)
serping1XP_005166940.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.