DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and si:ch211-186e20.7

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_021329695.1 Gene:si:ch211-186e20.7 / 566630 ZFINID:ZDB-GENE-110407-6 Length:410 Species:Danio rerio


Alignment Length:380 Identity:106/380 - (27%)
Similarity:190/380 - (50%) Gaps:35/380 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQ--LLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVL---KLPDDKKEVAAK 76
            ||...|:  :.:.:..:.|:..||.||.||||...:||...|.|::.:.:   ......:|:...
Zfish    43 FAFHLYKRVIESPDYQSKNIFFSPFSVSIALSELSLGAGGDTKQQLLSGIGYNSTTFSTEEMHQL 107

  Fly    77 YKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDI-----VDPNKASS 136
            :..||..:..|..| .:.:...:|.:.:|:....:.:.:|:.:.::...:|.     ||.     
Zfish   108 FHSLLEDIGNRTGV-DIDVGTALYASDRFKPHSKFLEDMKEFYHSDGFTVDFRVKETVDQ----- 166

  Fly   137 IVNNWVDNQTRGKIKDLVSSNDMSKMELI-VLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPV 200
             :||:...:|:||....|  :|:.:..|: :|..|||||:|:..|.|:.|::..|.:.|:.:|||
Zfish   167 -INNYAKKKTQGKFNQAV--DDLEEDTLMFLLTYIYFKGKWDKPFKPEKTRESTFHIDDKTTVPV 228

  Fly   201 EMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPD---QVDGLSELEKKI-----VGFKPK 257
            :||..::..:..:|:||..|::.|.|:: |.||.:.:||   :...:.:||..:     ..::..
Zfish   229 QMMHQYERLKVFYDAELSTKVLCLDYKD-SFSMFLAVPDDKMEHKNIKDLEMTVSRQHFEKWRRS 292

  Fly   258 LSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEE 322
            ..|..|.:.:||..::....|..:|..||:.|.|...|:|.. |....:.|.||:|||.::::|:
Zfish   293 AFKKTVDIYVPKLSLKTSYSLKDILKGMGMADMFSDKANFTG-VSEEKIFVSKVLHKATLDIDEQ 356

  Fly   323 GAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDR--ETIYFQGHFVKPNE 375
            |..|||.|. :.:|..:..|.|.:.||  .||...|.|:  :.|.|.|..|.|||
Zfish   357 GTTAAAVTG-VSMRVRLHNPLSILKFN--RPFMVFITDQTNDNILFFGKVVNPNE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 102/373 (27%)
si:ch211-186e20.7XP_021329695.1 alpha-1-antitrypsin_like 39..403 CDD:239011 102/373 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.