DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and serpinf2b

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001073479.1 Gene:serpinf2b / 563663 ZFINID:ZDB-GENE-061215-114 Length:479 Species:Danio rerio


Alignment Length:363 Identity:104/363 - (28%)
Similarity:174/363 - (47%) Gaps:57/363 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAAKYKDLLSKLEGREKVATLSLAN 97
            |:|.||||:.:|||...:||...|.:     |.|.....:....|...||.|....:..::.:|:
Zfish   127 NVIFSPLSLSVALSQLALGATNDTEE-----LLLHHLHADALPCYHTALSSLLRNFRKRSMPIAS 186

  Fly    98 RIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSI--VNNWVDNQTRGKIKDLVSSNDMS 160
            |||:...|:        .|..||.:::.:...:|...:.:  ||.||...|.|.|.:.:||...|
Zfish   187 RIYLKTGFK--------AKSDFMEDSQKLYDSEPATLTDVNDVNEWVKKVTNGHISEFLSSLPPS 243

  Fly   161 KMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMM-------SLFQSFRAAHDSELG 218
            .: ::::||:::||:|..:|:|..|...||.:.:.:.|.|:||       |:|     .| .||.
Zfish   244 AV-MMLINAMHYKGEWLTRFDPHFTSTENFYIDENQIVNVDMMLGPKYPLSVF-----TH-HELD 301

  Fly   219 AKIIELPYRNSSLSMLIFLPDQVD----------GLSELEKKIVGFKPKLSKMDVTLRLPKFKIE 273
            |::...|::... |:|:.:|....          .:|:|..::    |:...|.|  :|||||::
Zfish   302 AQVARFPFKGDR-SLLVVMPTSGHVNVSAIAAKLNISDLYSRL----PRERNMQV--KLPKFKLD 359

  Fly   274 FFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYS 338
            |...|.:.:.:||:...|  |....|.:....:.|..|.|.:.:|:|||||||.|||:::..|.:
Zfish   360 FNQDLQEAMTSMGLGKLF--SHPKLDRITEGPLFVSSVQHMSSVEINEEGAEAVAATSVVISRSN 422

  Fly   339 MPMPSSQMVFNADHPFAYVIRD--RETIYFQGHFVKPN 374
               ||    |..:.||.:.:.|  .:|..|.|....||
Zfish   423 ---PS----FTVNQPFFFALMDDLSQTPLFLGVISNPN 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 102/357 (29%)
serpinf2bNP_001073479.1 SERPIN 106..449 CDD:294093 102/357 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.