DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINF2

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_005256758.2 Gene:SERPINF2 / 5345 HGNCID:9075 Length:507 Species:Homo sapiens


Alignment Length:394 Identity:117/394 - (29%)
Similarity:186/394 - (47%) Gaps:81/394 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLK------LPDDKKEVAA 75
            |..|.:.|:|:.:...|||.|||||.:|||...:||:..|.|.::.||.      ||        
Human   105 FTADLFSLVAQTSTCPNLILSPLSVALALSHLALGAQNHTLQRLQQVLHAGSGPCLP-------- 161

  Fly    76 KYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKAS----- 135
               .|||:|..........||.|:|:.|.|.        :|:.|:.::|.:....|...:     
Human   162 ---HLLSRLCQDLGPGAFRLAARMYLQKGFP--------IKEDFLEQSEQLFGAKPVSLTGKQED 215

  Fly   136 --SIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSV 198
              :.:|.||...|.|||::.:|......: |::||||:|:|.|..||:|.||::.:|.:.:|.:|
Human   216 DLANINQWVKEATEGKIQEFLSGLPEDTV-LLLLNAIHFQGFWRNKFDPSLTQRDSFHLDEQFTV 279

  Fly   199 PVEMMS----------LFQ-SFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVD--------GL 244
            |||||.          |.| ..:.||          .|::| ::|.::.:|...:        .|
Human   280 PVEMMQARTYPLRWFLLEQPEIQVAH----------FPFKN-NMSFVVLVPTHFEWNVSQVLANL 333

  Fly   245 S--ELEKKIVGFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVH 307
            |  .|...:|..:|      ..:||||..::....|...|..:|:|:.|: :.|.:.:.|.|.| 
Human   334 SWDTLHPPLVWERP------TKVRLPKLYLKHQMDLVATLSQLGLQELFQ-APDLRGISEQSLV- 390

  Fly   308 VKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHF 370
            |..|.|::.:|::|.|.||||||::...|.|:   ||   |:.:.||.:.|.:..|  ..|.|..
Human   391 VSGVQHQSTLELSEVGVEAAAATSIAMSRMSL---SS---FSVNRPFLFFIFEDTTGLPLFVGSV 449

  Fly   371 VKPN 374
            ..||
Human   450 RNPN 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 115/388 (30%)
SERPINF2XP_005256758.2 alpha2AP 98..449 CDD:239008 115/388 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.