DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINB13

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:399 Identity:128/399 - (32%)
Similarity:208/399 - (52%) Gaps:41/399 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKK--EVA 74
            :||.|...|.::.|.|.| ..|:..||:.:..|:.|..:|.|..||.::..|.....:.|  .:.
Human     6 AVSTRLGFDLFKELKKTN-DGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIK 69

  Fly    75 AKYKDLLS-KLEGRE------------KVAT----------LSLANRIYVNKKFQLVPSYNQMVK 116
            |:.|:::. |.||:|            |..|          |::.||::..|.:..:..|...|:
Human    70 AEEKEVVRIKAEGKEIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVE 134

  Fly   117 DSFMAEAEAIDIVD-PNKASSIVNNWVDNQTRGKIKDLVSSNDM-SKMELIVLNAIYFKGQWEYK 179
            ..:.|..|.:|.|: .:::...:|:||:::|..|||||.....: |..:|:::|.:||||||:.:
Human   135 KYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDRE 199

  Fly   180 FNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGL 244
            |..:.||:..|.::...|..|:||:...||......:|.|||:.:||:|:.|||.:.||:.:|||
Human   200 FKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGL 264

  Fly   245 SEL------EKKIVGFKP-KLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAF-EKSADFKDLV 301
            .::      ||.:....| .:.:..|.|.||:|::|....|..||.|||:.||| |..||:..:.
Human   265 EKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMS 329

  Fly   302 ENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRE--TI 364
            ..|.::.:|.:|.:|:.|.|||.||||||.:.|...|.|...:   .:.:|||.:.||..|  :|
Human   330 SGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPGHEN---VHCNHPFLFFIRHNESNSI 391

  Fly   365 YFQGHFVKP 373
            .|.|.|..|
Human   392 LFFGRFSSP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 125/392 (32%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 127/397 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.