DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINB9

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens


Alignment Length:375 Identity:124/375 - (33%)
Similarity:212/375 - (56%) Gaps:15/375 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAA 75
            ::.|..||....::|.::|.::|:..||:|:..||:|..:||:..||.:|...|.| :.::::..
Human     5 SNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSL-NTEEDIHR 68

  Fly    76 KYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKAS-SIVN 139
            .::.||:::........|..|||::..|..|.:.::.:.....:.||.:.:..:...:.| ..:|
Human    69 AFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHIN 133

  Fly   140 NWVDNQTRGKIKDLVSSNDM-SKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMM 203
            .||..:|.|||::|:..:.: ::..|:::|||||||:|...|:...|::..|:::.::..||:||
Human   134 TWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMM 198

  Fly   204 SLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEK-----KIVGF-KPKLSK-M 261
            ....:|:.||..|:.|:::||||....||:|:.|||....||.:||     |:..: ||...| .
Human   199 YQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKST 263

  Fly   262 DVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEK-SADFKDLVENSNVHVKKVIHKAFIEVNEEGAE 325
            :|.:.|||||::....:..||..:||.|||:: .||...:....::.:.|.:||:|:||||||.|
Human   264 EVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTE 328

  Fly   326 AAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDR--ETIYFQGHFVKP 373
            ||||:: .||.....|.|... |.|||||.:.||..  .:|.|.|.|..|
Human   329 AAAASS-CFVVAECCMESGPR-FCADHPFLFFIRHNRANSILFCGRFSSP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 122/367 (33%)
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 123/373 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.