DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINB6

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_011512974.1 Gene:SERPINB6 / 5269 HGNCID:8950 Length:454 Species:Homo sapiens


Alignment Length:375 Identity:129/375 - (34%)
Similarity:211/375 - (56%) Gaps:27/375 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKK----EVAAKY 77
            ||.:..:.|.|:| :.|:..||:|:..||:|.||||:..||.:|..:|..  :|.    ::...:
Human    89 FALNLLKTLGKDN-SKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSF--NKSGGGGDIHQGF 150

  Fly    78 KDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDP-NKASSIVNNW 141
            :.||:::........|.:|||::..|....:.|:....:..:.||.|.:|.:.. .|:...:|.|
Human   151 QSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTW 215

  Fly   142 VDNQTRGKIKDLVSSNDMSKM-ELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSL 205
            |..:|.|||.:|:|...:..: .|:::||:||:|.|:.:|:.:.|::|.|:||..:..||:||..
Human   216 VAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFK 280

  Fly   206 FQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFK----PKLSKMD---V 263
            ..:|:..:..|:..:|:.|||....|:|:|.|||:...|..:||::...|    .:|..||   |
Human   281 QSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEV 345

  Fly   264 TLRLPKFKIEFFAQLNKVLVAMGIQDAFE-KSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAA 327
            .:.||:||:|....:..||..:|:.|||| ..|||..: ..:::.:.||:||:|:||||||.|||
Human   346 EVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGM-SQTDLSLSKVVHKSFVEVNEEGTEAA 409

  Fly   328 AATALLFVRYSMPMPSSQMV--FNADHPFAYVIRDRET--IYFQGHFVKP 373
            ||||.:     |.|..::.|  |.|||||.:.|:..:|  |.|.|.|..|
Human   410 AATAAI-----MMMRCARFVPRFCADHPFLFFIQHSKTNGILFCGRFSSP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 127/370 (34%)
SERPINB6XP_011512974.1 PAI-2 82..454 CDD:239013 128/373 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.