DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINA4

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:392 Identity:114/392 - (29%)
Similarity:181/392 - (46%) Gaps:56/392 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMR-----NVLKLPDDKKEVAAK 76
            ||..||.|:|.|....|:..||||:..|.:|..:||.:.:..::.     |:.:|  .:.:|...
Human    95 FAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTEL--SESDVHRG 157

  Fly    77 YKDLLSKL----EGRE-KV-ATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEA----IDIVDP 131
            ::.||..|    .|.| :| :.|.|::.:....||         :.|: ||..||    .:..|.
Human   158 FQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKF---------LNDT-MAVYEAKLFHTNFYDT 212

  Fly   132 NKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVL-NAIYFKGQWEYKFNPKLTKKRNFRVSDQ 195
            .....::|:.|..:|||||.||||  ::.|..|:|| |.||||..||..|....|..::|.|.:.
Human   213 VGTIQLINDHVKKETRGKIVDLVS--ELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDEN 275

  Fly   196 KSVPVEMMSLFQSFR-AAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIV------- 252
            .:|.|.||...|... ..||..|...::.:.|:..: ::...||:| ..:.|:|:.:.       
Human   276 TTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDA-TVFFILPNQ-GKMREIEEVLTPEMLMRW 338

  Fly   253 -------GFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKK 310
                   .|..||.     |.||||.|.....|:::|..:|..|.|.|.||...:.:...:...|
Human   339 NNLLRKRNFYKKLE-----LHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASK 398

  Fly   311 VIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVI--RDRETIYFQGHFVKP 373
            ..|||.::|:|.|.||||||:.....:|  ..:::.:...:.||..||  ...:::.|.|..|.|
Human   399 SFHKATLDVDEAGTEAAAATSFAIKFFS--AQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDP 461

  Fly   374 NE 375
            .:
Human   462 TK 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 112/385 (29%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 112/385 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.