DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINF1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001316832.1 Gene:SERPINF1 / 5176 HGNCID:8824 Length:418 Species:Homo sapiens


Alignment Length:387 Identity:109/387 - (28%)
Similarity:190/387 - (49%) Gaps:47/387 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMR-----NVLKLPD 68
            ||.:|| .|..|.|::.:..:...|::.|||||..|||...:||..:|...:.     :::..||
Human    54 LAAAVS-NFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPD 117

  Fly    69 DKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAE-------AI 126
                :...||:||..:...:|  .|..|:||...||.:        :|.||:|..|       .:
Human   118 ----IHGTYKELLDTVTAPQK--NLKSASRIVFEKKLR--------IKSSFVAPLEKSYGTRPRV 168

  Fly   127 DIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDM-SKMELIVLNAIYFKGQWEYKFNPKLTKKRNF 190
            ...:|......:||||..|.:||:..  |:.:: .::.:::|...:|||||..||:.:.|...:|
Human   169 LTGNPRLDLQEINNWVQAQMKGKLAR--STKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDF 231

  Fly   191 RVSDQKSVPVEMMSLFQS-FRAAHDSELGAKIIELPYRNSSLSMLIFLPDQV-DGLSELEKKIVG 253
            .:.::::|.|.|||..:: .|...||:|..||.:||. ..|:|::.|||.:| ..|:.:|:.:..
Human   232 YLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPL-TGSMSIIFFLPLKVTQNLTLIEESLTS 295

  Fly   254 -----FKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIH 313
                 ...:|..:...|.:||.|:.:..::.|.|..|.:|..|: |.||.. :....:.:.:|.|
Human   296 EFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFD-SPDFSK-ITGKPIKLTQVEH 358

  Fly   314 KAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            :|..|.||:||....:..|.....:.|:.     ::.:.||.:|:||.:|  :.|.|..:.|
Human   359 RAGFEWNEDGAGTTPSPGLQPAHLTFPLD-----YHLNQPFIFVLRDTDTGALLFIGKILDP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 105/377 (28%)
SERPINF1NP_001316832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
PEDF 40..415 CDD:239007 108/385 (28%)
O-glycosylated at one site 371..383 1/11 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.