DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINA10

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_016876842.1 Gene:SERPINA10 / 51156 HGNCID:15996 Length:484 Species:Homo sapiens


Alignment Length:378 Identity:96/378 - (25%)
Similarity:178/378 - (47%) Gaps:36/378 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QLLAKENA--------------ANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL----PDD 69
            |.||||.:              ..|::.||..:.:|::...:||...|..:::..|.|    |..
Human   113 QQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTK 177

  Fly    70 KKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKA 134
            ...:.:.:|.|...| .|.....|:..:..:::|.|.:..::..:.|..|..|...::..:.::|
Human   178 PGLLPSLFKGLRETL-SRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQA 241

  Fly   135 SSIVNNWVDNQTRGKIKDLVSS-NDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSV 198
            ..::|::::.:|||||..|... |..:|  ||:::.|.|||:|...|:|..|:...|.:...|::
Human   242 KRLMNHYINKETRGKIPKLFDEINPETK--LILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTI 304

  Fly   199 PVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIV-----GFKPKL 258
            .|.||.....|.:..|......:::|||:.:: :||:.|.:::.....||..:.     .:...:
Human   305 KVPMMYGAGKFASTFDKNFRCHVLKLPYQGNA-TMLVVLMEKMGDHLALEDYLTTDLVETWLRNM 368

  Fly   259 SKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDL-VENSNVHVKKVIHKAFIEVNEE 322
            ...::.:..||||::...:::::|..|||:..|...||..:| ....|:.|.:|:.:..|||:|.
Human   369 KTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDER 433

  Fly   323 GAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            |.||.|........||||     .|...|.||.::|.:..:  :.|.|..|.|
Human   434 GTEAVAGILSEITAYSMP-----PVIKVDRPFHFMIYEETSGMLLFLGRVVNP 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 94/373 (25%)
SERPINA10XP_016876842.1 PZI 114..478 CDD:239010 93/372 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.