DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINA5

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:409 Identity:129/409 - (31%)
Similarity:204/409 - (49%) Gaps:48/409 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCLLLL----------------------------ATSVSCRFADDFYQLLAKENAANNLISSPLS 40
            |||:||                            |.|....|..|.|:.||....:.::..||:|
Human     7 LCLVLLSPQGASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQSIFFSPVS 71

  Fly    41 VEIALSMAYMGARAKTAQEMRNVLKL---PDDKKEVAAKYKDLLSKLEGREKVATLSLANRIYVN 102
            :.::|:|..:||.:.|..::...|.|   ...:||:...::.||.:|........|||.|.::.:
Human    72 ISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTD 136

  Fly   103 KKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVL 167
            ....|..::...:|..::|:....:..|...|...:|::|..||:|||.||:.:.| |...:|::
Human   137 LVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLD-SNAVVIMV 200

  Fly   168 NAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLS 232
            |.|:||.:||..||.|.|::::|.|:.:..|.|.|||....:....|..|..:::.:||:.::.:
Human   201 NYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATA 265

  Fly   233 MLIFLP-----DQVD-GLSE--LEKKIVGFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQD 289
            :.| ||     .||: ||||  |.|.:..||    |..:.|.||||.||...||.|||.::||.:
Human   266 LFI-LPSEGKMQQVENGLSEKTLRKWLKMFK----KRQLELYLPKFSIEGSYQLEKVLPSLGISN 325

  Fly   290 AFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPF 354
            .|...||...:..:||:.|.:::|||.:||:|.|..|||||..:|...|..:.|.::|||  .||
Human   326 VFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFN--RPF 388

  Fly   355 AYVIRDRETIYFQGHFVKP 373
            ...|.| ..|.|.|...:|
Human   389 LMFIVD-NNILFLGKVNRP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 121/366 (33%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 121/367 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.