DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINE1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:373 Identity:107/373 - (28%)
Similarity:179/373 - (47%) Gaps:32/373 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFADDF----YQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKE 72
            |.....|.||    :|.:|:.:...|::.||..|...|:|..:....:|.|:::..:....|.|.
Human    29 SYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKG 93

  Fly    73 VAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSI 137
            :|...:.|..:|.|......:|..:.|:|.:..:||..:.......|.:..:.:|..:..:|..|
Human    94 MAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFSEVERARFI 158

  Fly   138 VNNWVDNQTRGKIKDLVSSNDMSKM-ELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVE 201
            :|:||...|:|.|.:|:....:.:: .|:::||:||.|||:..|....|.:|.|..||..:|.|.
Human   159 INDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRRLFHKSDGSTVSVP 223

  Fly   202 MMSLFQSFRAA---------HDSELGAKIIELPYRNSSLSMLIFLPDQVD-GLSEL-----EKKI 251
            ||:....|...         :|      |:||||...:|||.|..|.:.: .||.|     .:.|
Human   224 MMAQTNKFNYTEFTTPDGHYYD------ILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLI 282

  Fly   252 VGFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEK-SADFKDLVENSNVHVKKVIHKA 315
            ..:|..::::...|.||||.:|....|.|.|..:|:.|.|.: .|||..|.:...:||.:.:.|.
Human   283 SHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADFTSLSDQEPLHVAQALQKV 347

  Fly   316 FIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET 363
            .|||||.|..|:::||::   .|..|...:::.  |.||.:|:|...|
Human   348 KIEVNESGTVASSSTAVI---VSARMAPEEIIM--DRPFLFVVRHNPT 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 106/371 (29%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 107/373 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.