DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and serpinb5

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001011282.1 Gene:serpinb5 / 496735 XenbaseID:XB-GENE-5802997 Length:379 Species:Xenopus tropicalis


Alignment Length:374 Identity:109/374 - (29%)
Similarity:194/374 - (51%) Gaps:24/374 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAAKYKDLLS 82
            |.|.::.|.:::|.:|.:.|||.:..:||:...|::..||.|:...|.. :..|:....::.|.|
 Frog    12 AVDIFKKLCEKSATDNFVCSPLCISSSLSLIRKGSQGNTASELEKALHF-EKVKDPDFGFQLLSS 75

  Fly    83 KLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDI-VDPNKASSIVNNWVDNQT 146
            .:.......:|.|..|:||:...:....:....|..:..|.|.||. ....:|.:.:|:.|...|
 Frog    76 DISKISSANSLKLLKRVYVDNSIECKKDFINSAKKPYPLELETIDFKSQAEEARTQINSSVKELT 140

  Fly   147 RGKIKDLVSSNDMSK-MELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFR 210
            .|..:.:::.....: .::|:|.|..|||:|.|.||...||:.:|.::.:::.||:||.|.....
 Frog   141 DGNFETVLNEGSCDENTKIIMLGAASFKGKWVYTFNKSETKEMDFHINKKETKPVQMMHLEARLS 205

  Fly   211 AAHDSELGAKIIELPYRNSSLSMLIFLPDQVD----GLSELEKKIVGFK-------PKLSKMDVT 264
            ..:.:||...::|:|:::...||||.||..::    ||.:||:.:...|       ..::...|.
 Frog   206 IGYINELKTMVLEMPFQSKHFSMLILLPKDIEDDSTGLKKLEQDMTFEKYTHWTNPSMMANSKVK 270

  Fly   265 LRLPKFKIEFFAQLNKVLVAMGIQDAF-EKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAA 328
            :.|||||:|....|..:|.::||.||| |:::||.::.|:..:.:.:.|.||.|||:|:|.|:|.
 Frog   271 VSLPKFKMENSYDLKDMLKSLGINDAFNEEASDFSEMTESKGISISQAIQKACIEVDEDGTESAD 335

  Fly   329 ATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRE--TIYFQGHFVKPNE 375
            .:   ..|..|    ::..|.|||||.|::|..:  ||...|.:..|:|
 Frog   336 VS---MERRLM----NKEEFLADHPFIYILRHNKTRTIIMLGRYCGPSE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 107/367 (29%)
serpinb5NP_001011282.1 serpinB5_maspin 1..375 CDD:381013 107/370 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 227 1.000 Domainoid score I2443
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3392
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.