DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and serpinc1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001008153.1 Gene:serpinc1 / 493515 XenbaseID:XB-GENE-975782 Length:456 Species:Xenopus tropicalis


Alignment Length:382 Identity:109/382 - (28%)
Similarity:196/382 - (51%) Gaps:22/382 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLA--KENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEV 73
            :..:.:||..||:.||  |:| ..|:..||||:..|.:||.:||...|.:|:..|.......:..
 Frog    75 SQANAKFAIAFYKNLADSKQN-TENIFMSPLSISQAFTMAKLGACNNTLKELMEVFYFDTISERA 138

  Fly    74 AAKYKDLLSKLEGR-----EKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVD-PN 132
            :.:.....:||..|     .|.:.|...||::..|......:|..:.:..:.|:...::..: |.
 Frog   139 SDQIHYFFAKLNCRLFRKANKSSELVSVNRLFGEKSLTFNETYQDISELVYGAKLLPLNFKEKPE 203

  Fly   133 KASSIVNNWVDNQTRGKIKDLVSSNDMS-KMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQK 196
            .:..|:||||.::|..:|.|::....:: ...|:::|||||||.|:.|||.:.||...|...:..
 Frog   204 LSREIINNWVSDKTEKRITDVIPVGVITPDTVLVLINAIYFKGLWKSKFNSENTKMEQFYPDESN 268

  Fly   197 SVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELE-----KKIVGFKP 256
            ......|.....||.:...:.|.:::||||:...::|::.||.....|.::|     :|:..:..
 Frog   269 HCLAATMYQEGIFRYSSFKDDGVQVLELPYKGDDITMVLVLPSPETPLMKVEQNLTLEKLGNWLQ 333

  Fly   257 KLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFE-KSADFKDLVE--NSNVHVKKVIHKAFIE 318
            |..::.:::.||:|::|....:.:.|..||:.|.|: .||....:|.  .::::|....||||:|
 Frog   334 KSRELQLSVYLPRFRVEDSFSVKEKLQQMGLVDLFDPNSAKLPGIVAGGRTDLYVSDAFHKAFLE 398

  Fly   319 VNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRD--RETIYFQGHFVKP 373
            |||||:||||:||::....|:.:  :::.|.|:.||...||:  ..::.|.|....|
 Frog   399 VNEEGSEAAASTAVILTGRSLNL--NRITFRANRPFLVFIREVAINSVLFMGRVANP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 108/374 (29%)
serpinc1NP_001008153.1 serpinC1_AT3 61..455 CDD:381002 109/382 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.