DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Spn27A

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster


Alignment Length:366 Identity:101/366 - (27%)
Similarity:177/366 - (48%) Gaps:22/366 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLAKENAANNLISSPLSVEIALSM--AYMGARAKTAQEMRNVLKLPDDKKEVAAKYKDLLSKLEG 86
            :|..|.|..|:|.||.||::.|::  ...||..:|..|:.|.......:..|...|:..|:..:.
  Fly    84 VLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTDIRSQNNVREFYRKTLNSFKK 148

  Fly    87 REKV-ATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWVDNQTRGKI 150
            ..:: .|||:..:::.:...:....:...:|..:.:|.||:|..:|..|:..:|.|..|.|:|::
  Fly   149 ENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTNPEAAADAINAWAANITQGRL 213

  Fly   151 KDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDS 215
            :.||:.:::....:::.|.|||.|.|..:|.... :...||..|.:| ..|.|.....|......
  Fly   214 QQLVAPDNVRSSVMLLTNLIYFNGLWRRQFATTF-QGSFFRSKDDQS-RAEFMEQTDYFYYTTSE 276

  Fly   216 ELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFKPK-----LSKMDVTLRLPKFKIEFF 275
            :|.|:|:.|||:..: |:.:.||..::|:.:|.|.:...:.|     :.::.|.:.||||..::.
  Fly   277 KLKAQILRLPYKGKN-SLFVLLPYALNGIHDLVKNLENDELKSAQWAMEEVKVKVTLPKFHFDYQ 340

  Fly   276 AQLNKVLVAMGIQDAFEKSADFKDLVENSN----VHVKKVIHKAFIEVNEEGAEAAAATALLFVR 336
            ..|.:.|.::|:::.||.||....|...::    |.|..::.||.|.|||:|.||.|||.   |.
  Fly   341 QNLKETLRSLGVREIFEDSASLPGLTRGADVAGKVKVSNILQKAGINVNEKGTEAYAATV---VE 402

  Fly   337 YSMPMPSSQMV--FNADHPFAYVIRDRET--IYFQGHFVKP 373
            .......|..:  ||.:.||.:.|.:..|  |.|.|....|
  Fly   403 IENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKVHSP 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 100/361 (28%)
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 100/361 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.