DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Spn100A

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:359 Identity:86/359 - (23%)
Similarity:158/359 - (44%) Gaps:63/359 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAAKYKDLLSKLEGREKVA 91
            :|:...||..:....|.......|.|.|.||.|...| :||             |.|||...|.|
  Fly   296 EESQIKNLEENETVQEEEKLAKIMAAPALTAGEPEKV-RLP-------------LQKLENAVKTA 346

  Fly    92 TLSLANRIYVNKKFQLVPSYNQM--VKDSFMAEAEAIDIVDPNKASSIVNNWVDNQTRGKIKDLV 154
            ....|:.|.:..:..| ||.:::  .:..|..:    ||.....|:||.     .::.|      
  Fly   347 AKDGADEIMLALESHL-PSVSRVNGARSLFQQD----DITSALSANSIT-----GRSAG------ 395

  Fly   155 SSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRN----FRVSDQKSVPVEMMSLFQSFRAAHDS 215
                 ||.::::.|.:|::|.|.   ||....:..    |.::::.:|...||.....|:.|...
  Fly   396 -----SKSKMLLFNGLYYRGSWA---NPFYQLRDGSDEFFFMTNEDAVKAPMMHARGKFQVADLP 452

  Fly   216 ELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKI-----VGFKPKLSKMDVTLRLPKFKIEFF 275
            ::.|:::.|||..|..::.|.|||:.:|||::..::     :..|.:....::.:.:|||::|..
  Fly   453 QVKARVLSLPYETSRYALCIVLPDETEGLSDVISQLQTSDFLLAKKQFQMKELHISMPKFQVEET 517

  Fly   276 AQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYS- 338
            ::...:|..||::..|.:: |....|.|:.:|||.:::....:.|:|.|:.|.:.:|......: 
  Fly   518 SRSEAMLKQMGLKKVFSRTEAQLSLLSEDPDVHVDEIVQFVNVRVDEGGSSANSLSAATMQARTP 582

  Fly   339 --------MPMPSSQMV----FNADHPFAYVIRD 360
                    :|.|..::.    |..:.||||.|.|
  Fly   583 SVESTVLPVPEPEPELPGVERFEVNRPFAYFIVD 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 86/359 (24%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 60/256 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.