DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb6e

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001039000.2 Gene:Serpinb6e / 435350 MGIID:2667778 Length:429 Species:Mus musculus


Alignment Length:363 Identity:119/363 - (32%)
Similarity:201/363 - (55%) Gaps:23/363 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDK-----KEVAAKYKDLLSKLEGR 87
            |:::.|:..|..|:..:|::..|||...||.::..||.|  ||     .:|...::.||:::...
Mouse    73 EDSSKNVFFSSSSMFSSLALILMGANGTTASQISQVLSL--DKCSNGGADVQQGFQSLLTEVNKT 135

  Fly    88 EKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIV-DPNKASSIVNNWVDNQTRGKIK 151
            :....|..||:|:.:..|.::.|:.:.....:..|.|.:|.. .|.:....:|.||..:|:..|:
Mouse   136 DTGHMLRRANKIFSDNNFDIMESFKESCYKLYRVEIEKLDFKGTPEQCRQHINAWVAKKTKDVIR 200

  Fly   152 DLVSSNDM-SKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDS 215
            :|:|...: |...||::||.||||:||.:||.:.|::..|:||..:...|:|||...:|:..:..
Mouse   201 ELLSLYTVNSNTRLILVNATYFKGKWEKQFNKEDTREMPFKVSKNEKKTVQMMSKKSTFKTYYAE 265

  Fly   216 ELGAKIIELPYRNSSLSMLIFLPDQVDGLSELE-----KKIVGFK--PKLSKMDVTLRLPKFKIE 273
            |:...|:.|||.:..|||:|.|||:...||.:|     ||::.:.  .|:.:.:|.:.||:||:|
Mouse   266 EISTTIVFLPYTDKELSMIIMLPDEQVELSMVENQISYKKLIQWTRLVKMEEEEVQVFLPRFKLE 330

  Fly   274 FFAQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRY 337
            ....:..||..:|:.||||:| |||..:.....:.:..|:||:|:||||||.|||.||.::    
Mouse   331 ATYDMKDVLCKLGMTDAFEESRADFSGISSKKGLFLSNVVHKSFVEVNEEGTEAAVATEIV---- 391

  Fly   338 SMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            ::..|.:|....||.||.::|:..::  |.|.|.|..|
Mouse   392 TVGSPLTQRCLIADRPFLFLIQGDKSKEILFLGRFSSP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 117/358 (33%)
Serpinb6eNP_001039000.2 serpin 53..429 CDD:393296 118/361 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.