DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Spn85F

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_649965.2 Gene:Spn85F / 41221 FlyBaseID:FBgn0037772 Length:640 Species:Drosophila melanogaster


Alignment Length:570 Identity:99/570 - (17%)
Similarity:167/570 - (29%) Gaps:250/570 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAAKYKDLLSKLE----GRE---K 89
            ||...||.::...|...:.|:...||:|:|:||:||:::......|:|:..:|.    |.:   |
  Fly    87 NNFAFSPTALVSVLVALFEGSAGNTAEELRHVLQLPNNRDVTRVGYRDIHRRLRTYFFGSDNPLK 151

  Fly    90 VATLSLANRIYVNKKFQLV---------------------------------------------- 108
            ..:|:..| :.|.|.|:.|                                              
  Fly   152 GLSLNKGN-VTVLKDFETVLMFYGYDLSVDMLSSTPANLTSDAELVNTTMASNTTTMEMDAETTT 215

  Fly   109 ---------------------------------PSYNQMVKDSFMA---EAEAIDIVDPNKASSI 137
                                             |:..:...::..|   |.||.:....::|:.:
  Fly   216 SKDAESTTEEPATTTTEPPATTTAEPPTTTTETPAETEATTEAPAATSGEEEAAEPAGEDEAAEL 280

  Fly   138 VNNWV---DNQTRGKI-KDLVSSNDMSKMEL-------IVLNAIYFKG----------------- 174
            |:.:|   |::...:| |..||....||::.       |....||...                 
  Fly   281 VSAFVAEEDSEPLLRIQKARVSRLPTSKLQAPLKHSNPITPKPIYLPSARTVAMPMPMMARQVAE 345

  Fly   175 -----------------------------QWEYK------------------FNP---------- 182
                                         ...||                  |||          
  Fly   346 RKPPGTRQVISIIAPSVQPANISVTRKTKTARYKRHAIPAYKDLDANLFLTLFNPHTHVPHHPLH 410

  Fly   183 ----------KLTK-------------KRN---------FRVSDQKSVPVEMMSLFQSFRAA--- 212
                      .:|.             |.|         |.:.:|:.|    .:.|:.:.|.   
  Fly   411 FPPPVPAAFAPITNDFEPHYIGEAAEGKSNYNTDVISHVFYLGNQQVV----HTTFKVYNAVLYY 471

  Fly   213 -HDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFKPKLSKMDVTLRL--------- 267
             :...|...::||.......:::|.|||       ....||.....| |:..||||         
  Fly   472 KYFEHLKMSVLELELDTPEYNLMILLPD-------YHTDIVAAAASL-KLGPTLRLMRKQLKPRW 528

  Fly   268 -----PKFKIEFFAQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVHVKKVIHKAFIEVNEEGAEA 326
                 |.||:.....|...|..|||.|.||.: |||:.:.|...|:|:.:         |:..:.
  Fly   529 VQAIIPDFKLHGTMFLTNDLQNMGICDVFEPNRADFRPMTEEKGVYVRHI---------EQSIDV 584

  Fly   327 AAAT-ALLFVRYSMPMPSSQMVFNADHPFAYVI--RDRETIYFQGHFVKP 373
            ...| .:..::.:....|..:..:.:|||.:.|  ||.:.....|..:.|
  Fly   585 TIRTHPINQLKRNYGAQSKPIQISVNHPFLFFIVDRDLDVAVMSGRILNP 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 98/565 (17%)
Spn85FNP_649965.2 SERPIN 88..>204 CDD:294093 24/116 (21%)
SERPIN <450..634 CDD:294093 47/204 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.