DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Spn77Ba

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster


Alignment Length:381 Identity:101/381 - (26%)
Similarity:180/381 - (47%) Gaps:36/381 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLA--KENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAAKYK- 78
            ||.|..|.::  .|.|..:.:.||.||...|.:.|.|:..:|..:::..|::..:.:::...|| 
  Fly    79 FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINVEDEKLRGAYKV 143

  Fly    79 --DLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNW 141
              ..|:......:||||   ..||..|.:.:..:|...:: ::..:...:|...|:....| |..
  Fly   144 WSSFLNITTSTIEVATL---QAIYTGKGYPIKNNYRDAIQ-NYNVQPMEVDFYSPDSVIQI-NED 203

  Fly   142 VDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLF 206
            .:..|||.|...:...|:...::.:|:::||||||::.||..||::..| .|:...|..::..:.
  Fly   204 TNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPF-FSESGEVIGKIPMMV 267

  Fly   207 QSFRAAHDSE---LGAKIIELPY-RNSSLSMLIFLPDQVDGLSELEK--KIVGFKPKLSKM---- 261
            |....|:.|.   |...::|||| ....|:|::.||.:...|:::..  |.:|.:|.|.::    
  Fly   268 QEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFR 332

  Fly   262 -------DVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEV 319
                   :|.:.:|||.......|..||:.|||:|.|:::....|.: :|.:..|.|:|...|.|
  Fly   333 NRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRM-SSGLFAKLVVHSTKIIV 396

  Fly   320 NEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            :|:|..|.|.|.......:.| |.    |..:.||.|:|.::.|  :.|.|....|
  Fly   397 DEQGTTAGAVTEAALANKATP-PK----FLLNRPFQYMIVEKATGLLLFAGQVRNP 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 100/376 (27%)
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 100/376 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446308
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
54.950

Return to query results.
Submit another query.