DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINA2

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_006211.2 Gene:SERPINA2 / 390502 HGNCID:8985 Length:421 Species:Homo sapiens


Alignment Length:375 Identity:100/375 - (26%)
Similarity:178/375 - (47%) Gaps:32/375 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMR-----NVLKLPDDKKEVAAKY 77
            |.|.|:.||..:..:|::.:|.||.:|.:|..:|.:|.|..|:.     |:.:.|:.|  :...:
Human    61 AFDLYKELADLSQTSNVLVTPTSVAMAFAMLSLGTKADTRTEILEGLNVNLTETPEAK--IHECF 123

  Fly    78 KDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWV 142
            :.:|..|...:....|:..:.::|||..:||.::.:..|..:.:||.:|:..|..:|...:||:|
Human   124 QQVLQALSRPDTRLQLTTGSSLFVNKSMKLVDTFLEDTKKLYHSEASSINFRDTEEAKEQINNYV 188

  Fly   143 DNQTRGKIKDLVS--SNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSL 205
            :.:|..|:.|||.  ..|.|   |.:::.|.|.|:|:.||..:......|.|.|:..:.|.|::.
Human   189 EKRTGRKVVDLVKHLKKDTS---LALVDYISFHGKWKDKFKAEHIMVEGFHVDDKTIIRVPMINH 250

  Fly   206 FQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIV-----GFKPKLSKMDVTL 265
            ...|....|.||.:.::...|..::.:..| |||. ..:.:||:|:.     ..:.......:.|
Human   251 LGRFDIHRDRELSSWVLAQHYVGNATAFFI-LPDP-KKMWQLEEKLTYSHLENIQRAFDIRSINL 313

  Fly   266 RLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAAT 330
            ..||..|....:|.:||..:||...|...||...:.:.:.:.:.|.:|.|.:.::|:|.||..|.
Human   314 HFPKLSISGTYKLKRVLRNLGITKIFSNEADLSGVSQEAPLKLSKAVHVAVLTIDEKGTEATGAP 378

  Fly   331 AL---LFVRYSMPMPSSQMVFNADHPFAYVIRDRETIY--FQGHFVKPNE 375
            .|   .:.:|...|      ||  .||..:|:|..|.:  |.|..|.|.:
Human   379 HLEEKAWSKYQTVM------FN--RPFLVIIKDDITNFPLFIGKVVNPTQ 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 98/368 (27%)
SERPINA2NP_006211.2 SERPIN 62..418 CDD:214513 98/370 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.