DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and AT1G62160

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:258 Identity:72/258 - (27%)
Similarity:117/258 - (45%) Gaps:75/258 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DNQTRGKIKDLVSSNDMSKMELI---VLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMS 204
            |::.|..|...:.::...::..:   :.::::..|  ..|..||:...:||.             
plant    11 DDELRFFILSFLKASSTDELNAVLRKIASSVFVDG--SKKGGPKMRGHKNFE------------- 60

  Fly   205 LFQSFRAAHDSELGAKIIELPYR------NSSLSMLIFLPDQVDGLSELEKKIV---GF----KP 256
              :.:.||:|   |.|::.||||      |.:.||..:|||:...|.:|.|::.   ||    .|
plant    61 --KQYIAAYD---GFKVLRLPYRQGRDNTNRNFSMYFYLPDKKGELDDLLKRMTSTPGFLDSHTP 120

  Fly   257 KLSKMDV-TLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVN 320
            : .:::| ..|:|||||||               .||.|:.|.|...:.:.:     .||.||::
plant   121 R-ERVEVDEFRIPKFKIEF---------------GFEASSVFSDFEIDVSFY-----QKALIEID 164

  Fly   321 EEGAEAAAATALL-------FVRYSMPMPSSQMVFNADHPFAYVIRDRE--TIYFQGHFVKPN 374
            |||.|||||||.:       ||        ..:.|.|||||.::||:.:  |:.|.|....|:
plant   165 EEGTEAAAATAFVDNEDGCGFV--------ETLDFVADHPFLFLIREEQTGTVLFAGQIFDPS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 71/252 (28%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 68/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.