DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Spn53F

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster


Alignment Length:393 Identity:104/393 - (26%)
Similarity:172/393 - (43%) Gaps:48/393 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCLLLLATS-----VSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNV 63
            |.|:||..|     .:.:..|:.|..:....:..|::.|...:..::...|:|.....::::|..
  Fly     4 LLLILLGISRYRAQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKA 68

  Fly    64 LKLPDDKKEVAAKYKDLLSKLEGR--EKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAI 126
            :..   :....::||....|:...  :|........|.||.:..::...|...::.:   |..|.
  Fly    69 MHY---RGTHLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHT---EGRAR 127

  Fly   127 DIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDMS-KMELIVLNAIYFKGQWEYKFNPKLTKKRNF 190
            :|....:....||.:..::...:|..:|..:... ..:.:::|||:|...||..|||:.|..|.|
  Fly   128 NIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREF 192

  Fly   191 RVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKK----- 250
            ||:..|||.:.||.....|.......|.|..:.:|:.:..|.||:..|||.|||:.|:.|     
  Fly   193 RVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMN 257

  Fly   251 IVGFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLV-ENSNVHVKKVIHK 314
            |:.....|:.|||.:.:|||||....:|:.....|||:|.|:.|..|..|: .|:|..:..|||.
  Fly   258 ILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHV 322

  Fly   315 AFIEVNEEGAEAAAATALLFVRYSMPMPSSQM-------VFN------ADHPFAYVIRDRETIYF 366
            ...|..|:|               :..||:.:       .||      |.||||:.|.|..:|||
  Fly   323 VTFEFQEQG---------------IGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTSIYF 372

  Fly   367 QGH 369
            .||
  Fly   373 AGH 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 99/378 (26%)
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 98/372 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.