DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb6b

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_038951899.1 Gene:Serpinb6b / 364705 RGDID:1310452 Length:388 Species:Rattus norvegicus


Alignment Length:386 Identity:133/386 - (34%)
Similarity:209/386 - (54%) Gaps:37/386 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDK------KEVAA 75
            ||.:..:.|. |:::.|::.||||:...|:|.:|||:..||.:|...|.|  ||      ::|..
  Rat    11 FAFNLLKTLG-EDSSKNVLFSPLSISSGLAMVFMGAKGTTAHQMIQALSL--DKCSGRGSRDVHQ 72

  Fly    76 KYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVD-PNKASSIVN 139
            .::.||:|:........|..|||::..|.|.::.|:....:..:.||.|.:|... |.::...:|
  Rat    73 GFQSLLAKVNKTGTQYLLKTANRLFGEKTFDILASFKDACRKFYEAEMEELDFKGAPEQSRQHIN 137

  Fly   140 NWVDNQTRG-----------KIKDLVSSNDM-SKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRV 192
            .||..:|.|           ||.:|:||..: :...|:::|||||||.|:.:||.:.|::..|:|
  Rat   138 TWVAKKTEGQSISLNWNSQKKITELLSSGSVNANTPLVLVNAIYFKGNWKKQFNKEDTQEMPFKV 202

  Fly   193 SDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFK-- 255
            :..:..||:||....:|:..:..|:...|:.|||..:.|:|:|.|||:...|..:||:|...|  
  Rat   203 TKNEEKPVKMMFKKSTFKMTYVEEISTTILLLPYVGNELNMIIMLPDEHIELRMVEKEITYKKFI 267

  Fly   256 -----PKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVHVKKVIHK 314
                 .|:.:.:|.:.|||||:|....:..||..:|:.||||:. |||..:.....:.:.|||||
  Rat   268 EWTSLDKMEEREVEVFLPKFKLEENHDMKDVLHRLGMTDAFEQGMADFSGIASKEGLFLSKVIHK 332

  Fly   315 AFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            :|:||||||.||||||| ..|.:...:|    .|.|:|||.:.|:...|  |.|.|.|..|
  Rat   333 SFVEVNEEGTEAAAATA-ANVTFRCMVP----YFCANHPFLFFIQHSRTNGIVFCGRFSSP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 131/381 (34%)
Serpinb6bXP_038951899.1 serpin 1..388 CDD:422956 132/384 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.