DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Spn47C

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster


Alignment Length:378 Identity:120/378 - (31%)
Similarity:201/378 - (53%) Gaps:34/378 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL-PDDKKEVAAKY-KD 79
            ||.:.::.|..|....|::.||.....|:::.:|||..|:|.|:|:.|.| ..:|.|||.:: :.
  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAES 82

  Fly    80 LLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWVDN 144
            ...:....:|...|.|..|:|||::.::...:|.|..:.|.|||.:::.::|..:...||.|::.
  Fly    83 WTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKVNKWLEK 147

  Fly   145 QTRGKIKDL----VSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSL 205
            .|...:::|    |.::|.|   :|::|:::|:.:|...|..:||:..:|.::.::.:.|.||..
  Fly   148 HTFYTVRNLFTPEVFNSDSS---VILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQ 209

  Fly   206 FQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKI-------VGFKPKLSKMDV 263
            ...||.....:|.::|::||:..|:|:|:|.||..:|||.|||:|:       |..|..:.::||
  Fly   210 IGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAAKSLMKEVDV 274

  Fly   264 TLRLPKFKIEFFAQLNKVLVAMGIQDAFEK-SADFKDLVE-NSNVHVKKVIHKAFIEVNEEGAEA 326
            |  :|||:||....|...|..|||...|:. .||..||.| .:...:.:..||.|:.|.|.|.|.
  Fly   275 T--IPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLNVTEFGCEV 337

  Fly   327 AAATALLFVRYSMPMPS------SQMVFNADHPFAYVIRDRETIYFQGHFVKP 373
            |....:        .|.      .:..|.||.||.:.||||:.:||.||||||
  Fly   338 APEAEV--------QPEVLKKNPDRKFFKADRPFVFAIRDRKNVYFVGHFVKP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 115/373 (31%)
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 115/373 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
65.950

Return to query results.
Submit another query.