DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and serpind1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_878300.1 Gene:serpind1 / 359841 ZFINID:ZDB-GENE-030711-2 Length:507 Species:Danio rerio


Alignment Length:390 Identity:128/390 - (32%)
Similarity:194/390 - (49%) Gaps:47/390 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VSCRFADDFYQLLAKE-NAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPD-------- 68
            |:.||....|:.|... |..:|::.:|:.:.||:.|..:|....|.:::...:...:        
Zfish   137 VNARFGFRLYRKLRNRLNQTDNILLAPVGISIAMGMMGLGVGPNTQEQLFQTVGFAEFVNASNHY 201

  Fly    69 DKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPN- 132
            |...|...::.|..:|..|....||...|.:||.:..|:..|:....|..:.||.:::|..||. 
Zfish   202 DNSTVHKLFRKLTHRLFRRNFGYTLRSVNDLYVKRNVQIQDSFRADAKTYYFAEPQSVDFADPAF 266

  Fly   133 --KASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQ 195
              ||    |..:...|:|.||:.:.|.| ..|.:::||.:||||.||.||..:||..|.|||:::
Zfish   267 LVKA----NQRIQKITKGLIKEPLKSVD-PNMAVMLLNYLYFKGTWEQKFPKELTHHRQFRVNEK 326

  Fly   196 KSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFKPK--- 257
            |.|.|.||....|:.||.|.||...|::|||. .::||||.:|.::.|:..||::|   .|.   
Zfish   327 KQVRVLMMQNKGSYLAAADHELNCDILQLPYA-GNISMLIAVPQKLSGMRSLEQEI---SPTLVN 387

  Fly   258 --LSKMDVTLR---LPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVI----- 312
              ||.|....|   .|:||:|....|.:.|..||:.|.|.:..||..:..      :|||     
Zfish   388 KWLSNMTNRTREVVFPRFKLEQNYDLIEHLKEMGMTDIFTEKGDFSPMTS------EKVIINWFK 446

  Fly   313 HKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKPNE 375
            |:..|.|||||.||||.|.:.|    ||: |:|..|..|.||.::|.:..|  :.|.|..|.|::
Zfish   447 HQGSITVNEEGTEAAAMTHIGF----MPL-STQTRFIVDRPFLFLIYEHRTGCVVFMGRVVDPSQ 506

  Fly   376  375
            Zfish   507  506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 125/382 (33%)
serpind1NP_878300.1 HCII 61..505 CDD:239002 127/387 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.